| Clone Name | rbart53h01 |
|---|---|
| Clone Library Name | barley_pub |
>TOK1_YEAST (P40310) Outward-rectifier potassium channel TOK1 (Two-domain| outward rectifier K(+) channel YORK) Length = 691 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 141 LYFFVFTCNSPTFTCCLGPCWLIFLLTISQVVVIWR 34 +++FV +C P T CLGP + ++I+ VV WR Sbjct: 73 VFWFVVSCYFPVITACLGP--VANTISIACVVEKWR 106
>GUN3_BACS4 (P19570) Endoglucanase C precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) Length = 825 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +3 Query: 192 LTTEGASNIERMSTY*LD*KGRLVFFFPKITSQTIGENGPFLSKCSL 332 +++E SN+ + Y LD KG+ +F S+ G NGP+L++ + Sbjct: 309 ISSEDRSNVMANAKYALD-KGKAIFATEWGVSEADGNNGPYLNEADV 354
>CASR_BOVIN (P35384) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1085 Score = 28.1 bits (61), Expect = 5.5 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -1 Query: 226 ILSIFEA--PSVVKSKWLACCFYMMSTH**FVFLCVYMQFTNIYLLLGTLLADIFTNHKP 53 +L +FEA P+ KW + VFLC +MQ + L T + NH+ Sbjct: 703 VLLVFEAKIPTSFHRKWWGLNLQFL-----LVFLCTFMQIVICAIWLNTAPPSSYRNHEL 757 Query: 52 GGCYLEVSCME 20 + ++C E Sbjct: 758 EDEIIFITCHE 768
>NUIM_TRYBB (P30826) NADH-ubiquinone oxidoreductase subunit 8 (EC 1.6.5.3)| (Maxicircle iron-sulfur protein 1) Length = 145 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 144 DLYFFVFTCNSPTFTCCLGPCWLIFLLTISQVV 46 D FF F C F CC+ C I L +S +V Sbjct: 5 DFLFFFFVCFYMCFVCCVTICLPIELTIVSLLV 37
>SEQA_HAEIN (P44564) Protein seqA homolog| Length = 197 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 56 LMVSKNISQQGPKQQVNVGELHVNTKKYKSL 148 L+++ + Q PKQ +NV E+++ T K +S+ Sbjct: 45 LIITSAETDQKPKQAINVKEVNIKTTKKQSI 75
>CASR_MOUSE (Q9QY96) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1079 Score = 27.3 bits (59), Expect = 9.4 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -1 Query: 226 ILSIFEA--PSVVKSKWLACCFYMMSTH**FVFLCVYMQFTNIYLLLGTLLADIFTNHKP 53 +L +FEA P+ KW + VFLC +MQ + L T + NH+ Sbjct: 702 VLLVFEAKIPTSFHRKWWGLNLQFL-----LVFLCTFMQIVICIIWLYTAPPSSYRNHEL 756 Query: 52 GGCYLEVSCME 20 + ++C E Sbjct: 757 EDEIIFITCHE 767
>GPDA_LACLA (Q9CFX6) Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)| (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) Length = 341 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 89 PKQQVNVGELHVNTKKYKSLVRGHHVKA 172 P+Q + E H NT+ +K +V +KA Sbjct: 36 PEQMAEINEKHTNTRYFKDVVLDEKIKA 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,756,916 Number of Sequences: 219361 Number of extensions: 1088830 Number of successful extensions: 2431 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2431 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)