| Clone Name | rbart53g04 |
|---|---|
| Clone Library Name | barley_pub |
>SYC_MYCGE (P47495) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 428 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 169 VPKYLLLGKTRLVLSNNKYYGTEGVQHFALNSTRSRGKLAN 291 +P Y+ +LV N+ Y T+ +FA+NS + G LAN Sbjct: 115 IPDYI----DQLVNQNHAYVSTQNNVYFAVNSLKQYGYLAN 151
>V014_FOWPV (Q9J5I7) Putative ankyrin repeat protein FPV014| Length = 437 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 116 RRSL*RCCMSTDDMYVAKCIVCL 48 RRSL C++ DD +AKC+ C+ Sbjct: 341 RRSLLDLCLNCDDNAIAKCLNCI 363
>L_EBOSM (Q66802) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2210 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 248 CCTPSVP*YLLLERTSLVFPNNKYLGTEGVYDS 150 CCT VP L T+L +KY E +YDS Sbjct: 1350 CCTREVPAQYLTYTTTLNLDLSKYRNNELIYDS 1382
>HPPD_CAEBR (Q60Y65) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 393 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 223 YYGTEGVQHFALNST 267 YYG GVQH ALN+T Sbjct: 259 YYGGSGVQHIALNTT 273
>L_MABVP (P35262) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2331 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 251 KCCTPSVP*YLLLERTSLVFPNNKYLGTEGVYDS 150 KCCT VP L L NKY+ E VYD+ Sbjct: 1375 KCCTRHVPSEYLFFDKPLDVDLNKYMDNELVYDN 1408
>LRC8C_RAT (Q498T9) Leucine-rich repeat-containing protein 8C| Length = 803 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +2 Query: 110 IAFILFAS*LDI--NHYHILPPFLNTC 184 I +LF S LDI NH+ +LPP L C Sbjct: 748 IGNLLFLSYLDIKGNHFEVLPPELGDC 774
>LRC8C_MOUSE (Q8R502) Leucine-rich repeat-containing protein 8C (Protein AD158)| Length = 803 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +2 Query: 110 IAFILFAS*LDI--NHYHILPPFLNTC 184 I +LF S LDI NH+ +LPP L C Sbjct: 748 IGNLLFLSYLDIKGNHFEVLPPELGDC 774
>LRC8C_HUMAN (Q8TDW0) Leucine-rich repeat-containing protein 8C (Protein AD158)| Length = 803 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +2 Query: 110 IAFILFAS*LDI--NHYHILPPFLNTC 184 I +LF S LD+ NH+ ILPP L C Sbjct: 748 IGNLLFLSYLDVKGNHFEILPPELGDC 774
>LEP_STRR6 (P59662) Signal peptidase I (EC 3.4.21.89) (SPase I) (Leader| peptidase I) Length = 204 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 154 SYTPSVPKYLLLGKTRLVLSNNKYYGT 234 S+T +YLLLG RLV S++++ GT Sbjct: 155 SFTVPEGEYLLLGDDRLVSSDSRHVGT 181
>LEP_STRPN (O07344) Signal peptidase I (EC 3.4.21.89) (SPase I) (Leader| peptidase I) Length = 204 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 154 SYTPSVPKYLLLGKTRLVLSNNKYYGT 234 S+T +YLLLG RLV S++++ GT Sbjct: 155 SFTVPEGEYLLLGDDRLVSSDSRHVGT 181
>L_MABVM (P31352) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2331 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 251 KCCTPSVP*YLLLERTSLVFPNNKYLGTEGVYDS 150 KCCT VP L L NKY+ E VYD+ Sbjct: 1375 KCCTRHVPSEYLYFDKPLDVDLNKYMDNELVYDN 1408
>HPPD_XENTR (Q5BKL0) 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)| (4HPPD) (HPD) (HPPDase) (4-hydroxyphenylpyruvic acid oxidase) Length = 394 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 223 YYGTEGVQHFALNST 267 YYG+ GVQH ALN++ Sbjct: 259 YYGSAGVQHIALNTS 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,518,378 Number of Sequences: 219361 Number of extensions: 986858 Number of successful extensions: 2015 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2015 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)