Clone Name | rbart53f10 |
---|---|
Clone Library Name | barley_pub |
>ZN597_HUMAN (Q96LX8) Zinc finger protein 597| Length = 424 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 60 HLHLSNQTYKGYGPQIMHEECQKNCRGEVFPSYSCVAH 173 +L L +T+ GPQ H +C K+ R ++P+ S +H Sbjct: 282 NLALPEETFVS-GPQYQHTKCMKSFRQSLYPALSEKSH 318
>LNX2_HUMAN (Q8N448) Ligand of Numb-protein X 2 (Numb-binding protein 2) (PDZ| domain-containing RING finger protein 1) Length = 690 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 100 HKLCMKNAKRTVEEKCFHHIHVSLMHRVYCWKHSLILHKM 219 H C K + ++EK F + +H C K S+++HK+ Sbjct: 67 HTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKL 106
>SYL_BLOFL (Q7VRA6) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 867 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +2 Query: 47 KKMKTPSSLKSNIQRIWSTNYA*RMPKELSRRSVSIIFMCRSCIGYIVGNIHL 205 KK+ P ++ +Q+ W+ N + ++ +++ F C S + Y GN+H+ Sbjct: 2 KKLYFPHQIERIVQQHWNDNQTFSVTEDKNKQK----FYCLSMLPYPSGNLHM 50
>LNX2_MOUSE (Q91XL2) Ligand of Numb-protein X 2 (Numb-binding protein 2)| Length = 687 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 100 HKLCMKNAKRTVEEKCFHHIHVSLMHRVYCWKHSLILHKM 219 H C K + ++EK F + +H C K S+++HK+ Sbjct: 68 HTFCHKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKL 107
>RSE1_CANAL (Q5A7S5) Pre-mRNA-splicing factor RSE1| Length = 1219 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 96 HILCMFDLRDEGVFIFLLDLKPEKYLGSSIV 4 HI+ + + DE V+++ L LKP Y SSIV Sbjct: 30 HIIML--INDESVYLYNLTLKPPSYYISSIV 58
>MFGM_HUMAN (Q08431) Lactadherin precursor (Milk fat globule-EGF factor 8)| (MFG-E8) (HMFG) (Breast epithelial antigen BA46) (MFGM) [Contains: Lactadherin short form; Medin] Length = 387 Score = 27.7 bits (60), Expect = 8.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 114 EECQKNCRGEVFPSYSC 164 EE + RG+VFPSY+C Sbjct: 39 EEISQEVRGDVFPSYTC 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,135,057 Number of Sequences: 219361 Number of extensions: 719745 Number of successful extensions: 1964 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1964 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)