Clone Name | rbart53f06 |
---|---|
Clone Library Name | barley_pub |
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 48.1 bits (113), Expect = 5e-06 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 382 TTEELGLLSPDQGIAAAKELLR-QNKLPGFFIWSADSSKQSDYKFTYETRAQEIVAN 215 +T+ G L PD G A +L+ Q KL G F+WSAD S S+ F YE +AQ ++A+ Sbjct: 245 STDSSGGLKPDNGFFRACSILKKQGKLHGIFVWSADDSLMSNNVFRYEMQAQSMLAS 301
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 44.7 bits (104), Expect = 6e-05 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 382 TTEELGLLSPDQGIAAAKELLR-QNKLPGFFIWSADSSKQSDYKFTYETRAQEIVAN 215 +T+ G L P G A +L+ Q KL G F+WSAD S S+ F YE +AQ ++A+ Sbjct: 219 STDNSGGLKPRNGFFDACSILKKQGKLHGIFVWSADDSLMSNDVFKYEMQAQSLLAS 275
>AKIB1_MOUSE (Q6ZPS6) Ankyrin repeat and IBR domain-containing protein 1| (Fragment) Length = 1087 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 239 GLIGELVVALLGAVRRPDEEPRQLVLPQQLLGRGDALVR 355 G IG + + L +V R E PR + +LL GD+L+R Sbjct: 883 GAIGSSLPSRLDSVPRSTESPRAALSSSELLELGDSLMR 921
>MOT1_SCHPO (O43065) Probable helicase mot1 (EC 3.6.1.-) (TBP-associated factor| mot1) (Modifier of transcription 1) Length = 1953 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 286 SADSSKQSDYKFTYETRAQEIVANH*SP 203 SAD +DY FT ++R+ +V H +P Sbjct: 317 SADKKTGADYNFTAQSRSDRLVVEHKAP 344
>TRMB_BDEBA (Q6MQU0) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 209 Score = 28.1 bits (61), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 298 FFIWSADSSKQSDYKFTYETR 236 +F+W+ D +QS YK +ET+ Sbjct: 154 YFLWAMDEIRQSPYKIIFETQ 174
>RNC_GEOSL (Q74AX1) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 248 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -3 Query: 374 GAGAALSGPRHRRXXXXXXXXXXXGVLHLVGGQLQAERL 258 G G SG RHRR ++L GG ERL Sbjct: 114 GRGEERSGGRHRRSLLANALEALLAAMYLDGGMAPVERL 152
>HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6)| Length = 5635 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 355 PDQGIAAAKELLRQNKLPGFFIWSADSSKQSDYKFTYE 242 P+ I A K L + LPG FI+ ++ DY+ T+E Sbjct: 119 PEMSIGAIKIAL-EISLPGSFIYVFTDARSKDYRLTHE 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,633,886 Number of Sequences: 219361 Number of extensions: 872166 Number of successful extensions: 2292 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2292 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)