Clone Name | rbart53f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SBCC_ECOLI (P13458) Exonuclease sbcC | 30 | 1.1 | 2 | AT5F1_PONPY (Q5RFH9) ATP synthase B chain, mitochondrial precurs... | 28 | 7.3 |
---|
>SBCC_ECOLI (P13458) Exonuclease sbcC| Length = 1048 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +2 Query: 74 MGNHSAA--EIQTGTVQYNTLYKTGKELKLIIHHHGAEQSRLEQRKQRHEATW 226 + HSAA I+ + NT ++ L+ I HH A+QS Q++Q+ TW Sbjct: 299 IAEHSAALAHIRQQIEEVNTRLQSTMALRASIRHHAAKQSAELQQQQQSLNTW 351
>AT5F1_PONPY (Q5RFH9) ATP synthase B chain, mitochondrial precursor (EC| 3.6.3.14) Length = 256 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 128 LYKTGKELKLIIHHHGAEQSRLEQRKQRHEATW 226 LY+ KE+K + +H Q+ + Q++Q H W Sbjct: 186 LYRVYKEVKNRLDYHIYVQNMMRQKEQEHMVNW 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,970,410 Number of Sequences: 219361 Number of extensions: 627280 Number of successful extensions: 1743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1743 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)