ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart53f01 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PLIGGGLAGVIYE+LFIS THEQLPTTDY Sbjct: 222 PLIGGGLAGVIYEVLFISHTHEQLPTTDY 250
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 55.8 bits (133), Expect = 3e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PLIGGG+AG++YE+LFI+ THEQLPTTDY Sbjct: 221 PLIGGGIAGLVYEVLFINSTHEQLPTTDY 249
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 55.8 bits (133), Expect = 3e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PLIGGG+AG++YE+LFI+ THEQLPTTDY Sbjct: 222 PLIGGGIAGLVYEVLFINSTHEQLPTTDY 250
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 54.3 bits (129), Expect = 7e-08 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PL+GGG+AG+IYE+ FI+ THEQLPTTDY Sbjct: 223 PLVGGGIAGLIYEVFFINTTHEQLPTTDY 251
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 48.5 bits (114), Expect = 4e-06 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI-SRTHEQLPTTDY 243 PLIGGGLAG+IY+ +FI HEQLPTTDY Sbjct: 224 PLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI-SRTHEQLPTTDY 243 P +G +A +IY+++FI R H+QLPT DY Sbjct: 223 PFVGAAIAALIYDIIFIGQRPHDQLPTADY 252
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -3 Query: 329 PLIGGGLAGVIYELLF-ISRTHEQL 258 PLIGG LAG++YE LF + RTHE L Sbjct: 222 PLIGGPLAGLVYESLFLVKRTHEPL 246
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 34.3 bits (77), Expect = 0.080 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTD 246 PLIGGGLAG IYE + I R H +P D Sbjct: 217 PLIGGGLAGFIYENVLIDRPH--VPVAD 242
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 33.5 bits (75), Expect = 0.14 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRT-HEQLPTTD 246 PLIGG LAG++YE LF+ HE LP D Sbjct: 220 PLIGGPLAGLVYEGLFMGPPGHEPLPRND 248
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTD 246 PLIGGGLAG IY +FI H LPT++ Sbjct: 221 PLIGGGLAGFIYGDVFIG-CHTPLPTSE 247
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTD 246 PLIGGGLAG IY +FI H LPT++ Sbjct: 221 PLIGGGLAGFIYGDVFIG-CHTPLPTSE 247
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 32.3 bits (72), Expect = 0.30 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI-SRTHEQLPTTDY 243 P IG +A ++Y+ +FI S HE LP+ D+ Sbjct: 223 PFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 31.6 bits (70), Expect = 0.52 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTD 246 PLIGG LAG IY +FI+ H LPT++ Sbjct: 221 PLIGGALAGFIYGDVFIT-AHAPLPTSE 247
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 31.6 bits (70), Expect = 0.52 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI-SRTHEQLPTTDY 243 PLIGGGLAG+IY +F+ S H L + D+ Sbjct: 221 PLIGGGLAGLIYGNVFMGSSEHVPLASADF 250
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 31.6 bits (70), Expect = 0.52 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PL+GGGLAG++Y +++ H + ++++ Sbjct: 220 PLVGGGLAGLVYRYVYMCGDHAPVASSEF 248
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S++ G+I TGF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFNFALN 143 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFNFALN 143 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTDY 243 PLIGGGLAG++Y +FI +++ + DY Sbjct: 220 PLIGGGLAGLVYGDVFIG-SYQPVADQDY 247
>S26A1_RAT (P45380) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) (Canalicular sulfate transporter) (Sulfate/carbonate antiporter) Length = 703 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S + G+I TGF APQ P Sbjct: 313 GQLHTRFGSSVAGNIPTGFVAPQIPDP 339
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -1 Query: 217 PARPSVWSIASPLASSHESFNFALNE*IHPIPRVDRSISLWCCETCDDRPCQFAC 53 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -1 Query: 217 PARPSVWSIASPLASSHESFNFALNE*IHPIPRVDRSISLWCCETCDDRPCQFAC 53 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFISRTHEQLPTTD 246 PL+GG LAG+IY +FI ++ PTT+ Sbjct: 221 PLVGGALAGLIYGDVFIG-SYAPAPTTE 247
>RS7_BLOPB (Q492B0) 30S ribosomal protein S7| Length = 156 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 69 GRSSQVSQHHKLMDRSTLGMGWIHSFKAKLNDS*LEAR--GDAIDHTDGR 212 G + QV +L+ R+TL M WI K ND +E R + +D +G+ Sbjct: 82 GSTYQVPVEVRLVRRNTLAMRWIIEAARKRNDKSMELRLASELLDAIEGK 131
>RS7_BLOFL (Q7VRN8) 30S ribosomal protein S7| Length = 157 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 69 GRSSQVSQHHKLMDRSTLGMGWIHSFKAKLNDS*LEAR--GDAIDHTDGR 212 G + QV +L+ R+TL M WI K ND +E R + D ++G+ Sbjct: 83 GSTYQVPVEVRLVRRNTLAMRWIIESARKRNDKSMEMRLANELFDASEGK 132
>SYE_SULTO (Q971D0) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 566 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 59 KLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKIKRLMTG 175 K+ G VT F AP DGPI GN + I K + G Sbjct: 94 KVEGKFVTRF-APNPDGPIHLGNARAAIISYKYAEMYKG 131
>HMP_ERWCT (Q6D245) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 396 Score = 28.5 bits (62), Expect = 4.4 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Frame = +2 Query: 14 T*NYSGGRIHRFYTSKLTGSIVTGFTAPQTDG-PI---DPGNGM------DSFIQSKIKR 163 T +SG R R +L S++T FT TDG PI PG + DSF +I++ Sbjct: 146 TGGWSGVRPFRIVNKQLQSSVITSFTLEPTDGQPIADFQPGQYLAIYIKHDSFANQEIRQ 205
>S26A1_HUMAN (Q9H2B4) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 701 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H+ + S + G I TGF PQ P Sbjct: 309 GQLHKRFGSSVAGDIPTGFMPPQVPEP 335
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 223 PPPARPSVWSIASPLASSHESFNFALN 143 PPP P+V PL ++E F FA N Sbjct: 1178 PPPVCPNVLQPQGPLREANEGFTFAKN 1204
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 8/37 (21%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI--------SRTHEQLPTTDY 243 P IGG LA +IYE + I TH+ L DY Sbjct: 231 PFIGGALAALIYEYMIIPSVNEPPHHSTHQPLAPEDY 267
>SYE_SULAC (Q4J8P2) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 567 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 62 LTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKIKRLMTG 175 ++G +VT F AP DGP+ GN + I + R+ G Sbjct: 96 VSGVLVTRF-APNPDGPLHLGNARAAIISHEYARIYNG 132
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/44 (27%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 32 GRIHRFYT--SKLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKI 157 G +HR T + +TG+++ F + +T G +DP G + +++ + Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>S26A2_RAT (O70531) Sulfate transporter (Diastrophic dysplasia protein| homolog) (Solute carrier family 26 member 2) Length = 739 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQT-DGPIDPGNGMDSFIQSKIKRLMTGS 178 G+++ Y S + G I TGF PQ D + P +D+ S I +T S Sbjct: 350 GKLNENYNSSIAGQIPTGFMPPQAPDWSLIPNVAVDAIAISIIGFAITVS 399
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 8/37 (21%) Frame = -3 Query: 329 PLIGGGLAGVIYELLFI--------SRTHEQLPTTDY 243 P +G GLAG++YE L I H+ L DY Sbjct: 228 PFVGAGLAGLLYEYLVIPSADAAPHGGAHQPLAPEDY 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,619,382 Number of Sequences: 219361 Number of extensions: 677726 Number of successful extensions: 2104 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 2046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2102 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
