Clone Name | rbart53e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GAL4_YEAST (P04386) Regulatory protein GAL4 | 32 | 0.61 | 2 | CD2A2_RAT (Q8QZZ9) Cyclin-dependent kinase inhibitor 2A, isoform... | 29 | 3.0 | 3 | SYM_METMA (Q8PYJ4) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 28 | 5.2 |
---|
>GAL4_YEAST (P04386) Regulatory protein GAL4| Length = 881 Score = 31.6 bits (70), Expect = 0.61 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 19 WLENHNNTHDFRTNCSAKTYYYHNQIRTPYHPFRSNAKRRA 141 +++NHN T F NCS YY N + P SN+K A Sbjct: 564 YMDNHNVTPYFAWNCS---YYLFNAVLVPIKTLLSNSKSNA 601
>CD2A2_RAT (Q8QZZ9) Cyclin-dependent kinase inhibitor 2A, isoform 2 (p19ARF)| Length = 160 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 91 QIRTPYHPFRSNAKRRANKLKQESTSTVP 177 ++R P+HP + A+R A L + S ST P Sbjct: 84 ELRGPHHPLPTGARRSAGGLPRHSGSTAP 112
>SYM_METMA (Q8PYJ4) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 715 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 25 ENHNNTHDFRTNCSAKTYYYHNQIRTPYHP 114 ENHN THD + K Y Y I Y P Sbjct: 107 ENHNRTHDIVSRLIEKGYVYPKIIEIAYCP 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.127 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,376,399 Number of Sequences: 219361 Number of extensions: 409941 Number of successful extensions: 1215 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1215 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)