| Clone Name | rbart53d08 |
|---|---|
| Clone Library Name | barley_pub |
>PURA_BRUSU (P65879) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 93 RIKP*YKTYPMWA--TYGCKGWNKPPRLCAK 7 R+KP Y+T P W+ T G + WN P K Sbjct: 365 RVKPIYETLPGWSETTAGARSWNDLPAQAVK 395
>PURA_BRUME (P65878) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 93 RIKP*YKTYPMWA--TYGCKGWNKPPRLCAK 7 R+KP Y+T P W+ T G + WN P K Sbjct: 365 RVKPIYETLPGWSETTAGARSWNDLPAQAVK 395
>PURA_BRUAB (P0C115) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 93 RIKP*YKTYPMWA--TYGCKGWNKPPRLCAK 7 R+KP Y+T P W+ T G + WN P K Sbjct: 365 RVKPIYETLPGWSETTAGARSWNDLPAQAVK 395
>PURA_BRUA2 (Q2YQI5) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 93 RIKP*YKTYPMWA--TYGCKGWNKPPRLCAK 7 R+KP Y+T P W+ T G + WN P K Sbjct: 365 RVKPIYETLPGWSETTAGARSWNDLPAQAVK 395
>PTPRK_HUMAN (Q15262) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1439 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 126 STHTKIWEIGKNVNSLQTGQRKILHHRSYSASLHTSE 236 + H K+W +N + Q K ++HR ++AS E Sbjct: 223 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 259
>PTPRK_MOUSE (P35822) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1457 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 126 STHTKIWEIGKNVNSLQTGQRKILHHRSYSASLHTSE 236 + H K+W +N + Q K ++HR ++AS E Sbjct: 222 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 258
>RPOT1_NICSY (Q93Y94) DNA-directed RNA polymerase 1, mitochondrial precursor (EC| 2.7.7.6) (T7 bacteriophage-type single subunit RNA polymerase 1) (NsRpoT-A) Length = 1002 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 2 FFFAHNRG--GLFHPLHPYVAHIG*VLY*GLM 91 F++ HN G +P+HPY+ H+G L G++ Sbjct: 574 FYYPHNLDFRGRAYPMHPYLNHLGSDLCRGIL 605
>RPO1B_TOBAC (Q8L6J5) DNA-directed RNA polymerase 1B, mitochondrial precursor| (EC 2.7.7.6) (T7 bacteriophage-type single subunit RNA polymerase 1B) (NictaRpoT1-tom) Length = 1002 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 2 FFFAHNRG--GLFHPLHPYVAHIG*VLY*GLM 91 F++ HN G +P+HPY+ H+G L G++ Sbjct: 574 FYYPHNLDFRGRAYPMHPYLNHLGSDLCRGIL 605
>HST1_YEAST (P53685) NAD-dependent deacetylase HST1 (EC 3.5.1.-) (Homologous to| SIR2 protein 1) Length = 503 Score = 27.7 bits (60), Expect = 7.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 282 CHWDTSHRRREDLNMIPMYASSLSK 208 CHWD H++ +DL I + + K Sbjct: 465 CHWDIPHKKWQDLKKIDYNCTEIDK 489
>RPOT1_ARATH (P92969) DNA-directed RNA polymerase 1, mitochondrial precursor (EC| 2.7.7.6) Length = 976 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 2 FFFAHNRG--GLFHPLHPYVAHIG*VLY*GLM 91 F++ HN G +P+HPY+ H+G L G++ Sbjct: 548 FYYPHNVDFRGRAYPIHPYLNHLGSDLCRGIL 579
>HUL5_YEAST (P53119) Probable ubiquitin-protein ligase HUL5 (EC 6.3.2.-)| Length = 910 Score = 27.3 bits (59), Expect = 9.6 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 6/68 (8%) Frame = -2 Query: 285 LCHWDTSHRRREDLNMIPMY------ASSLSKIYGEVSSVDQFVTSLRFYLFPRFLCVYS 124 L + S R+ L+++ +Y A +LS + + +VD+F+ SL YL YS Sbjct: 104 LSSYPNSLGNRQLLSLLKLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYS 163 Query: 123 SCKMLGSL 100 S L + Sbjct: 164 SASKLADV 171
>KRE6_CANAL (P87023) Beta-glucan synthesis-associated protein KRE6| Length = 740 Score = 27.3 bits (59), Expect = 9.6 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +3 Query: 30 YSILYIRMLPTSDKFYIRV*CDHTSCPTFYMRSTHTKIWEIGKNVNSLQTGQRK 191 + I Y+R+ D+ I V CD T PT+ H ++E N+ S + G K Sbjct: 681 FRIDYVRVYQPPDQ--INVGCDPTDFPTYDYIQQHLNLYE-NANITSFEDGGYK 731
>JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone demethylation| protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) Length = 2350 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 330 HEDQAQRLHGKIP*HLCHWDTSH 262 H+ +++ L GKIP HL H SH Sbjct: 963 HQPESESLVGKIPDHLPHQSASH 985
>TAH18_YEAST (Q12181) Probable NADPH reductase TAH18 (EC 1.-.-.-)| Length = 623 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +3 Query: 90 CDHTSCPTFYMRSTHTKIWEIGKNVNSLQTGQRKILHHRSYSASLHTSESYSDLH 254 CD S P S KIW +V ++ GQ ++ R T + DL+ Sbjct: 325 CDFMSIPR---TSFFLKIWTFATDVTKMERGQEQLNDQREKLRQFATDQDMQDLY 376 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,789,505 Number of Sequences: 219361 Number of extensions: 1048898 Number of successful extensions: 2266 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2266 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)