| Clone Name | rbart53c02 |
|---|---|
| Clone Library Name | barley_pub |
>RPA4_YEAST (P46669) DNA-dependent RNA polymerase 36 kDa polypeptide (EC| 2.7.7.6) (A43) Length = 326 Score = 31.2 bits (69), Expect = 0.61 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = +3 Query: 21 NLFPMYLHNNSQSFISKHSRLDLPAYNKKDYTTILSQESLKI------SPEESTRKL 173 +L PMYL N Q + +H + YN K +L E LKI S E+++ KL Sbjct: 48 SLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKL 104
>YNG5_YEAST (P53943) Hypothetical 65.3 kDa protein in SUN4-MAS5 intergenic| region Length = 586 Score = 30.8 bits (68), Expect = 0.80 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +1 Query: 19 ITSFRCTYIITARVSSQSTQGLISLHTTKKTTLQSC 126 ITSF C+Y + +S+ ST L+ L+ TK +T SC Sbjct: 465 ITSFVCSYCAMSTLST-STTLLVDLYPTKSSTASSC 499
>HCN3_RAT (Q9JKA8) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 3 Length = 780 Score = 28.9 bits (63), Expect = 3.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = -3 Query: 405 PKGARISGSQPA--DRAHGRALDN---SGAKQLPVRGVTSGPPTLVKLRRS 268 P+G +S SQP+ RA G SG+++LP G+ + PP V+ RS Sbjct: 713 PRGRPLSASQPSLPQRATGDGSPRRKGSGSERLPPSGLLAKPPGTVQPSRS 763
>HCN3_MOUSE (O88705) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 3 (Hyperpolarization-activated cation channel 3) (HAC-3) Length = 779 Score = 28.5 bits (62), Expect = 4.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = -3 Query: 405 PKGARISGSQPA--DRAHGRALDN---SGAKQLPVRGVTSGPPTLVKLRRS 268 P+G +S SQP+ RA G SG+++LP G+ + PP V+ RS Sbjct: 712 PRGRPLSASQPSLPQRATGDGSPRRKGSGSERLPPSGLLAKPPGTVQPPRS 762
>SPTN4_HUMAN (Q9H254) Spectrin beta chain, brain 3 (Spectrin, non-erythroid beta| chain 3) (Beta-IV spectrin) Length = 2564 Score = 28.1 bits (61), Expect = 5.2 Identities = 27/79 (34%), Positives = 34/79 (43%), Gaps = 10/79 (12%) Frame = -2 Query: 355 EGSG*LRSKAAPSQGGHLRAP-----YTCQAQA*LPHR*RSAARKKMADPRAMAGNDQQV 191 EG G RS++AP+QGG AP +T Q + L RK+ D + N V Sbjct: 2391 EGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFL-------LRKRELDANRKSSNRSWV 2443 Query: 190 ILVFVQS-----FRVDSSG 149 L V S F DS G Sbjct: 2444 SLYCVLSKGELGFYKDSKG 2462
>VPS_BPPRD (P27392) Protein S (GpS)| Length = 117 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 339 SGAKQLPVRGVTSGPPTLVKLRRSC 265 +G+ LPV G TS PTL RSC Sbjct: 48 AGSVTLPVAGYTSPSPTLPNRNRSC 72
>ZN335_HUMAN (Q9H4Z2) Zinc finger protein 335| Length = 1342 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 345 DNSGAKQLPVRGVTSGPPTLV 283 D+S PV GVT GPP LV Sbjct: 87 DSSSVSHGPVAGVTGGPPALV 107
>RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2| Length = 1516 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 262 EAATPELDKCRGPGG 306 EA T ELD+C GPGG Sbjct: 196 EAETMELDECGGPGG 210
>CT128_HUMAN (Q9BQN1) Protein C20orf128| Length = 733 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 200 STSYISFCSEFPGRFLGRYLERFLRQDCSVV 108 ST ++CS+ RF G+ LE+F+ DC V Sbjct: 219 STCGDTYCSKAGRRFTGQALEKFVLIDCEQV 249 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,384,409 Number of Sequences: 219361 Number of extensions: 996009 Number of successful extensions: 2433 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2427 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)