| Clone Name | rbart53b01 |
|---|---|
| Clone Library Name | barley_pub |
>SYS_BUCAI (P57398) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 427 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 34 EFKTRNSRYNILKGPEPKNII*GKTSSKGIV*TGTLLQILEMDQHSNG 177 +F+ R + K E KN + G+ TL ILE QHSNG Sbjct: 360 DFQARRIKARYRKKSEQKNFFVHTLNGSGLAIGRTLAAILENYQHSNG 407
>ADA2B_BRARE (Q90WY5) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Alpha(2B)AR) Length = 510 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 184 LCYHYCVGPFPESEGAFLFRRFPWMMFCPR*CFSVLDPLIYCILNSSF 41 +C C P P LF+ F W+ +C S L+P+IY I N F Sbjct: 456 VCPESCALPEP------LFKFFFWIGYCN----SCLNPVIYTIFNKDF 493
>DGKM_CAEEL (Q10024) Putative diacylglycerol kinase K06A1.6 (EC 2.7.1.107)| (Diglyceride kinase) (DGK) (DAG kinase) Length = 937 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 71 RVQNRKTLSRAKHHPRESSKQERSF 145 R+ NRK SR HPR+ K R F Sbjct: 379 RLANRKRSSRTPSHPRKHKKSHRQF 403
>ADA2C_CAVPO (Q60476) Alpha-2C adrenergic receptor (Alpha-2C adrenoceptor)| (Alpha-2C adrenoreceptor) Length = 455 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 184 LCYHYCVGPFPESEGAFLFRRFPWMMFCPR*CFSVLDPLIYCILNSSF 41 +C C P P LF+ F W+ +C S L+P+IY I N F Sbjct: 400 ICREACQLPTP------LFKFFFWIGYCN----SSLNPVIYTIFNQDF 437
>ADA2C_BRARE (Q90WY6) Alpha-2C adrenergic receptor (Alpha-2C adrenoceptor)| (Alpha-2C adrenoreceptor) (Alpha(2C)AR) Length = 432 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 184 LCYHYCVGPFPESEGAFLFRRFPWMMFCPR*CFSVLDPLIYCILNSSF 41 +C C P P LF+ F W+ +C S L+P+IY I N F Sbjct: 379 ICREPCAIPDP------LFKFFFWIGYCN----SSLNPVIYTIFNQDF 416
>ADA2C_HUMAN (P18825) Alpha-2C adrenergic receptor (Alpha-2C adrenoceptor)| (Alpha-2C adrenoreceptor) (Alpha-2 adrenergic receptor subtype C4) Length = 462 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 184 LCYHYCVGPFPESEGAFLFRRFPWMMFCPR*CFSVLDPLIYCILNSSF 41 +C C P P LF+ F W+ +C S L+P+IY + N F Sbjct: 407 ICREACQVPGP------LFKFFFWIGYCN----SSLNPVIYTVFNQDF 444 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,874,006 Number of Sequences: 219361 Number of extensions: 508292 Number of successful extensions: 1201 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)