| Clone Name | rbart52h01 |
|---|---|
| Clone Library Name | barley_pub |
>VG18_ICHV1 (Q00120) Hypothetical gene 18 protein| Length = 318 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 110 KGSVPFSLTLMVCHGGACVTQIPM 39 + S+P TL+VCHG VT +P+ Sbjct: 257 RASIPRRFTLIVCHGTVAVTAVPV 280
>TWK7_CAEEL (P34410) TWiK family of potassium channels protein 7| Length = 557 Score = 29.6 bits (65), Expect = 2.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 216 SHHPFCVVDRFASSHFVPFFLCSLGCLRFVDK 121 S F V + + S H +PF + C+R++D+ Sbjct: 493 SREAFIVENLYVSKHIIPFIPTDIRCIRYIDQ 524
>5HT2C_MOUSE (P34968) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) (5HT-1C) Length = 459 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 91 EKGTEPLQAPLVNEAQAP*RTEKERNKMGGGEAVHNAK 204 +KG E AP N Q P R +KE+ G +A++N K Sbjct: 271 KKGDEEENAPNPNPDQKPRRKKKEKRPRGTMQAINNEK 308
>NEST_HUMAN (P48681) Nestin| Length = 1618 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 82 SVKEKGTEPLQAPLVNEAQAP*RTEKERNKMGGGEA 189 S+K G E L+ E QAP T +E NK GG E+ Sbjct: 827 SLKSAGQENLETLKSPETQAPLWTPEEINKSGGNES 862
>TLL2_MOUSE (Q9WVM6) Tolloid-like protein 2 precursor (EC 3.4.24.-)| Length = 1012 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 234 ATKHWTSHHPFCVVDRFASSHFVPFFLCSLGCLRFVDKR 118 A +HW H V+R F+ F + GC +V +R Sbjct: 180 AMRHWEKHTCVTFVERTDEESFIVFSYRTCGCCSYVGRR 218
>TLL2_HUMAN (Q9Y6L7) Tolloid-like protein 2 precursor (EC 3.4.24.-)| Length = 1015 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 234 ATKHWTSHHPFCVVDRFASSHFVPFFLCSLGCLRFVDKR 118 A +HW H ++R F+ F + GC +V +R Sbjct: 183 AMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRR 221
>TLL2_XENLA (O57382) Tolloid-like protein 2 precursor (EC 3.4.24.-) (Xenopus| tolloid) (Metalloprotease xolloid) Length = 1019 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 234 ATKHWTSHHPFCVVDRFASSHFVPFFLCSLGCLRFVDKR 118 A +HW H V+R F+ F GC +V +R Sbjct: 186 AMRHWKKHTCVTFVERTDEESFIVFTYRPCGCCSYVGRR 224
>IQCB1_MOUSE (Q8BP00) IQ calmodulin-binding motif-containing protein 1| Length = 598 Score = 27.7 bits (60), Expect = 8.3 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 7/64 (10%) Frame = +2 Query: 41 LVFELHRHLRDTPLVLKRREQNPYRLLLSTKRK-------HPSEQRKKGTKWEEAKRSTT 199 ++ EL+R + L LK + Q + LS + + HP + K + EE T Sbjct: 335 MMLELNRQKEEEDLRLKLQLQRQRAMRLSRESRLNMLEIIHPGQVEKYNREMEEKSALTI 394 Query: 200 QKGW 211 QK W Sbjct: 395 QKHW 398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,257,575 Number of Sequences: 219361 Number of extensions: 675685 Number of successful extensions: 2252 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2248 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)