| Clone Name | rbart52g01 |
|---|---|
| Clone Library Name | barley_pub |
>P2RX5_HUMAN (Q93086) P2X purinoceptor 5 (ATP receptor) (P2X5) (Purinergic| receptor) Length = 421 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 3 SQTEAITSTGKNVPQK*LTKTDAAQAGRTTRIGGAVKSGPILYRENECRANGDIY 167 +Q + + + + +P +K AG G VK+G L REN R +I+ Sbjct: 112 NQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIF 166
>TRM1_MOUSE (Q3TX08) N(2),N(2)-dimethylguanosine tRNA methyltransferase (EC| 2.1.1.32) (tRNA(guanine-26,N(2)-N(2)) methyltransferase) (tRNA 2,2-dimethylguanosine-26 methyltransferase) (tRNA(m(2,2)G26)dimethyltransferase) Length = 663 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 67 MLRKQEEQPE*VVLLNPARFCTEKTSAEPMGTFT 168 M RK ++ P + N RFC E+ A+P+ T T Sbjct: 26 MERKAQKPPSPPAMENGTRFCEERPPADPVATVT 59
>MARE1_HUMAN (Q15691) Microtubule-associated protein RP/EB family member 1| (APC-binding protein EB1) (End-binding protein 1) (EB1) Length = 267 Score = 28.5 bits (62), Expect = 4.3 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 15 AITSTGKNVPQK*LTKTDAAQAG--RTTRIGGAVKSGPILYRENECRANGD 161 ++ + N P+K LT + AA T R A K+GP + R+N NGD Sbjct: 139 SLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGD 189
>YM8C_YEAST (P38430) Hypothetical 36.1 kDa protein in TPS3-IPP2 intergenic| region (ORF3) Length = 313 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 202 NWLVDEYCHALVDPNNRSDHPLRADDGNIEG 294 N LVD +CH + DP D+ DDG +G Sbjct: 2 NKLVDAHCHVITDP----DNTFCGDDGGSQG 28
>DNAK_MYCPA (Q00488) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) (70 kDa antigen) Length = 622 Score = 28.1 bits (61), Expect = 5.7 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 8/70 (11%) Frame = +3 Query: 30 GKNVPQK*LTKTDAAQAGRTTRIGG----AVKSGPILYRENECRANGDIYKC----SATK 185 G VP++ L+K DAA A T +GG A+KS + IY+ SA Sbjct: 532 GSKVPEETLSKVDAAIADAKTALGGTDITAIKSAMEKLGQESQALGQAIYEATQAESAQA 591 Query: 186 GG*ARQLAGG 215 GG AGG Sbjct: 592 GGPDGAAAGG 601
>AT10B_HUMAN (O94823) Probable phospholipid-transporting ATPase VB (EC 3.6.3.1)| Length = 1461 Score = 28.1 bits (61), Expect = 5.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 74 RSICFCKLLLWYIFACGCDS 15 +++C+ LL WY F CG S Sbjct: 1119 KNVCYVNLLFWYQFFCGFSS 1138
>VGLL_PRVKA (P52512) Glycoprotein L precursor| Length = 156 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 145 HSFSLYRIGPDLTAPPILVVLPACAASVFVSYFCGTFLPVDVIASV 8 H + Y + PD+TA +VV P C+ + + GT V+ ++ Sbjct: 72 HPYIAYSLPPDMTAVTSVVVKPYCSPPEVILWASGTAYLVNPFVAI 117
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -2 Query: 98 YSGCSS-CLRSICFCKLLLWYIFACGCDS 15 Y GC S C +C CK + + AC C S Sbjct: 28 YGGCGSGCCVPVCCCKPVCCCVPACSCSS 56
>YIZI_SCHPO (Q9US42) Hypothetical protein C1002.18 in chromosome I| Length = 399 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 155 WGHLQMLGN*GWLSKTIGWWMNIAMPWWIQTIDQITPF 268 W LQ L W +T N+ W++ TID I PF Sbjct: 227 WSELQTLLIPIWPVRTSFEGQNLGDAWYLSTIDAIQPF 264
>FSTL1_RAT (Q62632) Follistatin-related protein 1 precursor (Follistatin-like| 1) Length = 306 Score = 27.7 bits (60), Expect = 7.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 171 ICKCPHWLCTRFLC 130 +C C HW+CT C Sbjct: 252 VCSCGHWVCTAMTC 265
>FSTL1_MOUSE (Q62356) Follistatin-related protein 1 precursor (Follistatin-like| 1) (TGF-beta-inducible protein TSC-36) Length = 306 Score = 27.7 bits (60), Expect = 7.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 171 ICKCPHWLCTRFLC 130 +C C HW+CT C Sbjct: 252 VCSCGHWVCTAMTC 265
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 95 SGC----SSCLRSICFCKLLLWYIFACGCDS 15 SGC SSC IC CK + + AC C S Sbjct: 40 SGCGGCGSSCCVPICCCKPVCCCVPACSCSS 70
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 107 STTYSGCSS-CLRSICFCKLLLWYIFACGCDS 15 S++ GC S C +C CK + ++ AC C S Sbjct: 46 SSSCGGCGSRCYVPVCCCKPVCSWVPACSCTS 77
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 95 SGC----SSCLRSICFCKLLLWYIFACGCDS 15 SGC SSC +C CK + + AC C S Sbjct: 121 SGCGGCGSSCCVPVCCCKPMCCCVPACSCSS 151
>CUP52_GALME (Q24998) Pupal cuticle protein PCP52 precursor (GMPCP52)| Length = 353 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -3 Query: 211 PANCLA*PPLVAEHL*MSPLALHSFSL---YRIGPDLTAPPILVVLPACAASVFV 56 PA+ +A PL A L SPL L + +L + GP P + + P + FV Sbjct: 291 PASAIAAAPLTAASLIASPLTLPTLNLEQQWVTGPVFVQPGLKAISPISLQTPFV 345
>YL185_MIMIV (Q5URB5) Hypothetical protein L185| Length = 392 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -2 Query: 137 FSVQNRAGFNSTTYSGCSSCLRSICFCKLLLWYIFACGC 21 F V R + T S C C C+CK YIF C Sbjct: 63 FIVGKRIHCQTNTISNCECCTNYTCYCK----YIFQNRC 97
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 95 SGC----SSCLRSICFCKLLLWYIFACGCDS 15 SGC SSC IC CK + + AC C S Sbjct: 19 SGCGGCGSSCCVPICCCKPVCCCVPACSCSS 49
>KDGD_PSEPK (Q88GW8) 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)| (5-keto-4-deoxy-glucarate dehydratase) (KDGDH) Length = 303 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 63 TDAAQAGRTTRIGGAVKS---GPILYRENECRANGDI 164 T+A+Q G + KS G ++Y N CR N D+ Sbjct: 116 TEASQDGVAAHVEAVCKSVNIGVVVYNRNVCRLNADL 152
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -2 Query: 95 SGC----SSCLRSICFCKLLLWYIFACGCDS 15 SGC SSC IC CK + + AC C S Sbjct: 26 SGCGGCGSSCCVPICCCKPVCCCVPACSCSS 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,241,888 Number of Sequences: 219361 Number of extensions: 1092537 Number of successful extensions: 2836 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2835 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)