| Clone Name | rbart52f08 |
|---|---|
| Clone Library Name | barley_pub |
>NGFV_CRODU (Q9DEZ9) Venom nerve growth factor precursor (vNGF)| Length = 241 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 204 TSSFVVASTAAGRRSQWRSIGQPSSCVALV 115 T++FV A T G ++ WR I S+CV ++ Sbjct: 204 TNTFVKALTMEGNQASWRFIRIDSACVCVI 233
>NGFV_BUNMU (P34128) Vemon nerve growth factor precursor (v-NGF)| Length = 243 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 204 TSSFVVASTAAGRRSQWRSIGQPSSCVALV 115 T +FV A T G R+ WR I ++CV ++ Sbjct: 207 TDTFVKALTMEGNRASWRFIRIDTACVCVI 236
>NGFV1_PSETE (Q3HXY9) Venom nerve growth factor 1 precursor (vNGF-1)| Length = 243 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 204 TSSFVVASTAAGRRSQWRSIGQPSSCVALV 115 T +FV A T G R+ WR I ++CV ++ Sbjct: 207 THTFVKALTMEGNRASWRFIRIDTACVCVI 236
>NGFV1_NAJSP (Q5YF90) Venom nerve growth factor 1 precursor (vNGF-1) (Nerve| growth factor I) Length = 243 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 204 TSSFVVASTAAGRRSQWRSIGQPSSCVALV 115 T +FV A T G R+ WR I ++CV ++ Sbjct: 207 THTFVKALTMEGNRASWRFIRIDTACVCVI 236
>NGFV1_HOPST (Q3HXY0) Venom nerve growth factor 1 precursor (vNGF-1)| Length = 243 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 204 TSSFVVASTAAGRRSQWRSIGQPSSCVALV 115 T +FV A T G R+ WR I ++CV ++ Sbjct: 207 TQTFVRALTMEGNRASWRFIRIDTACVCVI 236
>NIFY_AZOBR (P25315) Protein nifY| Length = 227 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 132 KKAGQSISTGNAALQPSRPRQNCLSVASS 218 + A S STG+ AL RPRQ C V +S Sbjct: 197 RHATASSSTGDVALAARRPRQRCRHVPAS 225
>FGL2_MOUSE (P12804) Fibroleukin precursor (Fibrinogen-like protein 2)| (Prothrombinase) (Cytotoxic T-lymphocyte-specific protein) Length = 432 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = -1 Query: 185 PRRLQGGVPSGDRLASLLHVSPWWKVTCLSFSACNHVLIQKEKPAYNHVFLG 30 P R PSG+ L + S WW +CLS + QK K N +F G Sbjct: 352 PDRDNDRYPSGN--CGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWG 401 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,869,320 Number of Sequences: 219361 Number of extensions: 666434 Number of successful extensions: 1727 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1726 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)