Clone Name | rbart52f02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DHB8_CANFA (Q5TJF5) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.... | 30 | 2.2 | 2 | DHB8_HUMAN (Q92506) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.... | 30 | 2.2 | 3 | DHB8_PIG (Q9XT00) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.62... | 28 | 6.4 |
---|
>DHB8_CANFA (Q5TJF5) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.62)| (17-beta-HSD 8) (17-beta-hydroxysteroid dehydrogenase 8) Length = 259 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 67 RINEDEQWSKIVSSNLKGLPT*LTHAVLCAPTHGCRGCAENMIS 198 R++ED+ W ++++ NLKG+ A + GCRG N+ S Sbjct: 112 RMSEDD-WDRVIAVNLKGIFLVTQAAAQALVSSGCRGSIINISS 154
>DHB8_HUMAN (Q92506) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.62)| (17-beta-HSD 8) (17-beta-hydroxysteroid dehydrogenase 8) (Protein Ke6) (Ke-6) Length = 261 Score = 29.6 bits (65), Expect = 2.2 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 34 CAIYVQRLLGYRINEDEQWSKIVSSNLKGLPT*LTHAVLCAPTHGCRGCAENMIS 198 CA Q ++ED+ W K+++ NLKG A ++GCRG N+ S Sbjct: 103 CAGITQDEFLLHMSEDD-WDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISS 156
>DHB8_PIG (Q9XT00) Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.62)| (17-beta-HSD 8) (17-beta-hydroxysteroid dehydrogenase 8) (Ke6 protein) (Ke-6) Length = 259 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 67 RINEDEQWSKIVSSNLKGLPT*LTHAVLCAPTHGCRGCAENMIS 198 R++ED+ W K+++ NLKG+ A + GC G N+ S Sbjct: 112 RMSEDD-WDKVIAVNLKGIFLVTQAAAQALVSSGCPGSIINISS 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,015,565 Number of Sequences: 219361 Number of extensions: 461062 Number of successful extensions: 927 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)