Clone Name | rbart52e07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SNPH_HUMAN (O15079) Syntaphilin | 29 | 2.7 | 2 | CAC1G_RAT (O54898) Voltage-dependent T-type calcium channel alph... | 28 | 4.7 | 3 | EGF_RAT (P07522) Pro-epidermal growth factor precursor (EGF) [Co... | 28 | 6.1 | 4 | Y764_XANAC (Q8PPC2) UPF0102 protein XAC0764 | 28 | 6.1 | 5 | ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing prote... | 28 | 6.1 |
---|
>SNPH_HUMAN (O15079) Syntaphilin| Length = 538 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 97 LTKTHSIGRENKQQARAASRGKQRRAQRPAESRDPNGGPSV 219 LT+THS+ + +R S G +RR P RD G S+ Sbjct: 38 LTRTHSLMAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSL 78
>CAC1G_RAT (O54898) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) Length = 2254 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 34 VHDMTVHHPHHS*TLHGSKH*LTKTHSIGRENKQQARAASRGKQRRAQRPAESRDPNGGP 213 VH + HH HH H H T + R + + + G +R P + P+GGP Sbjct: 491 VHHLVHHHHHH----HHHYHLGNGTLRVPRASPEIQDRDANGSRRLMLPPPSTPTPSGGP 546
>EGF_RAT (P07522) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1133 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 118 GRENKQQARAASRGKQRRAQ--RPAESRDPNGGPSVLYHIYS 237 G EN+ QA + R KQRR Q RDPN S Y+ Sbjct: 306 GTENRAQASDSERCKQRRGQCLYSLSERDPNSDSSACAEGYT 347
>Y764_XANAC (Q8PPC2) UPF0102 protein XAC0764| Length = 122 Score = 28.1 bits (61), Expect = 6.1 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = -2 Query: 250 RRRMNCRYGRGQRGLRWGPWILLVFARASAFLGSPPALAA 131 R R + R+G G + W LV A A FLG+ PALAA Sbjct: 55 RYRRDDRFGGGAASVDWRKRRKLVLA-AQLFLGAHPALAA 93
>ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing protein 1B (ARID| domain-containing protein 1B) (Osa homolog 2) (hOsa2) (p250R) (BRG1-binding protein hELD/OSA1) (BRG1-associated factor 250b) (BAF250B) Length = 2236 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +1 Query: 52 HHPHHS*TLHGSKH*LTKTHSIGR-----ENKQQARAASRGKQRRAQRPAESRDPNGG 210 HH HH+ H H L H++ + + +QQ + + +Q++ Q P + + GG Sbjct: 85 HHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGG 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,663,737 Number of Sequences: 219361 Number of extensions: 664092 Number of successful extensions: 1991 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1990 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)