Clone Name | rbart52d08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CBP_MOUSE (P45481) CREB-binding protein (EC 2.3.1.48) | 28 | 4.7 | 2 | CBP_HUMAN (Q92793) CREB-binding protein (EC 2.3.1.48) | 28 | 4.7 |
---|
>CBP_MOUSE (P45481) CREB-binding protein (EC 2.3.1.48)| Length = 2441 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 34 GIPRKKK*EMAEHY-TSRITHSTGNRLTKVIKRPNQPGAGRRYVR 165 G PRK+ A+ T+R+ + +R+ K ++R N P AG +VR Sbjct: 1317 GRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVR 1361
>CBP_HUMAN (Q92793) CREB-binding protein (EC 2.3.1.48)| Length = 2442 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 34 GIPRKKK*EMAEHY-TSRITHSTGNRLTKVIKRPNQPGAGRRYVR 165 G PRK+ A+ T+R+ + +R+ K ++R N P AG +VR Sbjct: 1316 GRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVR 1360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,297,163 Number of Sequences: 219361 Number of extensions: 552486 Number of successful extensions: 1184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1184 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)