ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart52d06 |
|---|---|
| Clone Library Name | barley_pub |
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -2 Query: 165 YFFFLRIPRYITTWVYVLLCLFVSLFARV 79 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>VGLM_BUNSH (P04875) M polyprotein precursor [Contains: Glycoprotein G2;| Nonstructural protein NS-M; Glycoprotein G1] Length = 1441 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/50 (24%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = -2 Query: 171 ISYFFFLRIPRYITTWVYVLLCLFVSL--------FARVGRLYEQQCDVF 46 I++++F+ I Y TW +++ L + L F+ + +Y ++CD++ Sbjct: 354 INFYYFVCIMNYAVTWGLIIIGLLIGLLFKKYQHRFSNLYAMYCEECDMY 403
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -2 Query: 165 YFFFLRIPRYITTWVYVLLCLFVSLFARV 79 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>AZR1_YEAST (P50080) Azole resistance protein 1| Length = 613 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 146 FHVTLPLGFMYCFVYLLVYLRGSGDY--TSSNVMCFSNNFVLLCRSI 12 F+V LP+G + F++L Y G + T N+ F + F+ + R++ Sbjct: 224 FYVNLPIGGLAFFLFLFFYNPGLSTFQETMDNIRKFPSQFIEIVRNV 270
>Y148_MYCGE (P47394) Hypothetical protein MG148| Length = 409 Score = 29.6 bits (65), Expect = 1.8 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 3/87 (3%) Frame = +1 Query: 28 KTKLLEKHITLLLV*SPDPRK*TNK*TKQYINPSGNVTWNTKEKKVGNGRALHVT---HH 198 KT L +K LLL + + K + YIN + KE ++ N + L + Sbjct: 78 KTMLNDKEQALLLKTKLELQNQFQKQIENYINEINKLKLTNKELEITNQKQLESSLKLQR 137 Query: 199 TQYREQINQSN*TTKSTRRRPAVRTSI 279 ++ E+INQ N T + + + A R+SI Sbjct: 138 NEFEEKINQQNLTIEKLKIQQA-RSSI 163
>NU5M_ANOGA (P34854) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 580 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = -3 Query: 164 TFFSFVFHVTLPLGFMYCFVYLLVYLRGSGDYTSSNVMCFSNNFVLLCRSICVI 3 +FF F F G C+ + LVY +GD+ SS++ +++ + SIC + Sbjct: 381 SFFLFFFST----GLTVCYSFRLVYYSMTGDFNSSSLHPLNDSGWTMLFSICFL 430
>ITPR1_MOUSE (P11881) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (Inositol 1,4,5-trisphosphate-binding protein P400) (Purkinje cell protein 1) (Pro Length = 2749 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>RT03_ACACA (P46754) Mitochondrial ribosomal protein S3| Length = 298 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 243 FGRLITLVNLFPVLCVMRDV*CSAISYFFFLRIPRYITTW 124 F R L +F + +V + IS FFF+R+ +Y T W Sbjct: 169 FSRSSFLSKIFIIGLSKMNVNANIISEFFFIRLTQYYTIW 208
>ITPR2_RAT (P29995) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_MOUSE (Q9Z329) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) (Inositol 1,4,5-trisphosphate type V receptor) Length = 2701 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_HUMAN (Q14571) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_BOVIN (Q8WN96) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_HUMAN (Q14643) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP3R) Length = 2758 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_BOVIN (Q8WN95) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2664 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_RAT (P29994) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP-3-R) Length = 2750 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_RAT (Q63269) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) (IP3R-3) Length = 2670 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_MOUSE (P70227) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2670 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_BOVIN (Q9TU34) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) Length = 2709 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR_DROME (P29993) Inositol 1,4,5-trisphosphate receptor (InsP3 receptor)| (InsP3R) Length = 2838 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 622 LLHNNRKLLEKHIT 635
>ITPR3_HUMAN (Q14573) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2671 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 16 LLHNKTKLLEKHIT 57 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>M130_STRPU (P08472) Mesenchyme-specific cell surface glycoprotein precursor| (MSP130) Length = 779 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 97 NK*TKQYINPSGNVTWNTKEKKVGNGRALHVTHHT 201 N TK+Y+NP G +T V NG + + + T Sbjct: 202 NNYTKKYVNPEGTITTVRLAGSVSNGPSQQIVNTT 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,855,071 Number of Sequences: 219361 Number of extensions: 921690 Number of successful extensions: 1838 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1838 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
