| Clone Name | rbart52c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATL2D_ARATH (Q9SL78) Putative RING-H2 finger protein ATL2D precu... | 37 | 0.015 | 2 | ATL4J_ARATH (Q5XF85) RING-H2 finger protein ATL4J precursor | 36 | 0.033 | 3 | DX26B_HUMAN (Q5JSJ4) Protein DDX26B | 29 | 5.3 | 4 | MYOF_HUMAN (Q9NZM1) Myoferlin (Fer-1-like protein 3) | 28 | 9.0 |
|---|
>ATL2D_ARATH (Q9SL78) Putative RING-H2 finger protein ATL2D precursor (RING-H2| finger protein ATL12) Length = 390 Score = 37.4 bits (85), Expect = 0.015 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 170 WVPIARRTARWFAARSKEEDVN 105 W+PIARRTA+WF R K D+N Sbjct: 361 WLPIARRTAQWFVNREKSNDLN 382
>ATL4J_ARATH (Q5XF85) RING-H2 finger protein ATL4J precursor| Length = 432 Score = 36.2 bits (82), Expect = 0.033 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 170 WVPIARRTARWFAARSKEEDVN 105 W+PIAR+TA+WFA R K +N Sbjct: 403 WLPIARKTAQWFANREKRSQIN 424
>DX26B_HUMAN (Q5JSJ4) Protein DDX26B| Length = 861 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 404 VGEEPPEERGIRDNDHDGGDXXXXXXXERKRLLQ 303 VG++PP+E GI+ +H GG ++LL+ Sbjct: 441 VGKKPPQEIGIKVKNHSGGGMSLTHNKNFRKLLK 474
>MYOF_HUMAN (Q9NZM1) Myoferlin (Fer-1-like protein 3)| Length = 2061 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 413 IIFVGEEPPEERGIRDNDHD 354 ++ G+EPP ER RDND D Sbjct: 322 VLGTGDEPPPERRDRDNDSD 341 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.126 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,530,610 Number of Sequences: 219361 Number of extensions: 357032 Number of successful extensions: 1239 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)