ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart52b10 |
|---|---|
| Clone Library Name | barley_pub |
>ZFPL1_MOUSE (Q9DB43) Zinc finger protein-like 1| Length = 310 Score = 31.6 bits (70), Expect = 0.49 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 194 PCARICRSTCWNHQMGPGAHVLS*MVRKHGQCLHSSPLQWLRDS 325 P ++ C+ H++ H L V H +C+ S LQWL+DS Sbjct: 7 PKRKVTNLFCFEHRVNVCEHCL---VANHAKCIVQSYLQWLQDS 47
>ZFPL1_HUMAN (O95159) Zinc finger protein-like 1 (Zinc-finger protein MCG4)| Length = 310 Score = 31.6 bits (70), Expect = 0.49 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 194 PCARICRSTCWNHQMGPGAHVLS*MVRKHGQCLHSSPLQWLRDS 325 P ++ C+ H++ H L V H +C+ S LQWL+DS Sbjct: 7 PKRKVTNLFCFEHRVNVCEHCL---VANHAKCIVQSYLQWLQDS 47
>ZFPL1_BRARE (P62447) Zinc finger protein-like 1| Length = 317 Score = 31.6 bits (70), Expect = 0.49 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 194 PCARICRSTCWNHQMGPGAHVLS*MVRKHGQCLHSSPLQWLRDS 325 P ++ C+ H++ H L V H +C+ S LQWL+DS Sbjct: 7 PKKKVTNLFCFKHRVNVCEHCL---VSNHNKCIVQSYLQWLQDS 47
>HHIP_HUMAN (Q96QV1) Hedgehog-interacting protein precursor (HHIP) (HIP)| Length = 700 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +1 Query: 97 CMSHGKTNMSSPERA----NATQPGLCGDHCEDFA*TVCSYLPLHLLESSD 237 C H ++ SPER + P LC D+C++F T ++P L ++D Sbjct: 115 CSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTAD 165
>MTHA_HAEPH (P50192) Modification methylase HphIA (EC 2.1.1.37)| (Cytosine-specific methyltransferase HphIA) (M.HphIA) (M.Hphi(C)) Length = 372 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 19 LLYCLVYSISQQLVYCCTQLYI 84 LLYC+ + +S+ L+YC + YI Sbjct: 27 LLYCIKFFLSKYLIYCMSLTYI 48
>YQB6_CAEEL (Q09259) Hypothetical protein C30G12.6| Length = 1100 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -3 Query: 260 SEHELQVPSDDSNRWSGKYEHTVYAKSSQ*SPHSPGCVALALSGDDI 120 +E E+ +PS NRW GK ++ KS + +AL+L DI Sbjct: 249 TESEVMIPSGVKNRWMGKLAKSLLDKSPE--VRCKAVIALSLWDHDI 293
>RSD1_SCHPO (O13845) RNA-binding protein rsd1| Length = 604 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -3 Query: 296 NEDIDRVFEPFSSEHELQVPSDDSNRWSG----KYEHTVYAKSS 177 +ED+ +FEPF + + DD NR G +Y + + A+++ Sbjct: 353 DEDVKAIFEPFGDIEFVHLQRDDQNRSKGFGYIQYRNPISARNA 396
>HHIP_MOUSE (Q7TN16) Hedgehog-interacting protein precursor (HHIP) (HIP)| Length = 700 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +1 Query: 97 CMSHGKTNMSSPER----ANATQPGLCGDHCEDFA*TVCSYLPLHLLESSD 237 C H ++ +PER + P LC D+C++F T ++P L ++D Sbjct: 115 CSPHSQSLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTAD 165
>ARI3A_HUMAN (Q99856) AT-rich interactive domain-containing protein 3A (ARID| domain-containing protein 3A) (B-cell regulator of IgH transcription) (Bright) (E2F-binding protein 1) Length = 593 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 371 EGIRALSIDKDNAPKWSPATIEEVKNEDIDRVFEPFSSEHE 249 E ++ D+D PKW +EE ED + E + E E Sbjct: 112 EHFEDMASDEDMKPKWEEEEMEEDLGEDEEEEEEDYEDEEE 152
>HSP90_THEPA (P24724) Heat shock protein 90 (HSP90)| Length = 721 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 113 KPICRHQKGLMLHSLGYVVITAKISHRPCARICRSTCWNHQM 238 +P+C+H K ++ + VV + + PCA + W+ M Sbjct: 564 EPLCKHIKEVLHDKVEKVVCGTRFTDSPCALVTSEFGWSANM 605
>SIA1_KLULA (Q6CPQ2) Protein SIA1 precursor| Length = 578 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = -3 Query: 305 EVKNEDIDRVFEPFSSEHELQVPSDDSNR------WSGKY 204 ++KN DID ++++E V D SNR WS K+ Sbjct: 145 KIKNNDIDGYHVHSNTDNEFYVKDDSSNRFNPDMKWSAKF 184
>STCF_EMENI (Q12609) Probable sterigmatocystin biosynthesis P450 monooxygenase| STCF (EC 1.14.-.-) (Cytochrome P450 60A2) Length = 506 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +3 Query: 171 SLRRFRIDRVLVFAAPP 221 +LRR+R+DR++ F APP Sbjct: 207 ALRRYRLDRLIEFLAPP 223
>HSP90_THEAN (Q4UDU8) Heat shock protein 90 (HSP90)| Length = 722 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +2 Query: 113 KPICRHQKGLMLHSLGYVVITAKISHRPCARICRSTCWNHQM 238 +P+C+H K ++ + VV + + PCA + W+ M Sbjct: 565 EPLCKHIKEVLHDKVEKVVCGTRFTDSPCALVTSEFGWSANM 606
>SCML2_HUMAN (Q9UQR0) Sex comb on midleg-like protein 2| Length = 700 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 368 GIRALSIDKDNAPKWSPATIEEVKNEDIDRVFEPFS 261 G++ +IDK N PATI +VK +++ F+ +S Sbjct: 175 GMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWS 210
>XRCC3_ARATH (Q9FKM5) DNA-repair protein XRCC3 homolog (X-ray repair| cross-complementing protein 3 homolog) (AtXRCC3) Length = 304 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 67 CTQLYICTQTCMSHGKTNMSS 129 C QL +CTQ +SHG N SS Sbjct: 56 CLQLSLCTQLPISHGGLNGSS 76
>TCPE_HUMAN (P48643) T-complex protein 1 subunit epsilon (TCP-1-epsilon)| (CCT-epsilon) Length = 541 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -3 Query: 365 IRALSIDKDNAPKWSPATIEEVKNEDIDRVFEP--FSSEHELQVPSDDSNRWSGKYEHTV 192 I+ + +DKD + P +E+ K + FEP ++H+L V S + + KYE Sbjct: 225 IKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEK 284 Query: 191 YAKSSQ 174 + + Q Sbjct: 285 FEEMIQ 290
>SYE_LACJO (Q74L27) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 499 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 341 DNAPKWSPATIEEVKNEDIDRVFEPFSSE 255 + AP+ S A IEE+K +D V E F + Sbjct: 396 EEAPELSDAEIEEIKKDDARPVIEEFKKQ 424 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,447,172 Number of Sequences: 219361 Number of extensions: 1129385 Number of successful extensions: 2965 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2963 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
