| Clone Name | rbart51h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HUTG_FUSNN (Q8RFN0) Formimidoylglutamase (EC 3.5.3.8) (Formimino... | 29 | 3.1 | 2 | HIS8_SHIBS (Q323J1) Histidinol-phosphate aminotransferase (EC 2.... | 28 | 7.0 |
|---|
>HUTG_FUSNN (Q8RFN0) Formimidoylglutamase (EC 3.5.3.8) (Formiminoglutamase)| (Formiminoglutamate hydrolase) Length = 318 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 27 IEQNLLLQFTICGTTWHSTPKTGYSTPKTNYLWYFESTG 143 +E+N + TIC +H T G S P+T +W ++ G Sbjct: 230 LERNDYIHLTICTDVFHITCAPGVSAPQTFGIWPNQAIG 268
>HIS8_SHIBS (Q323J1) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 356 Score = 28.1 bits (61), Expect = 7.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 112 VFGVEYPVFGVECQVVPHIVNW 47 ++GV GVEC+ VP + NW Sbjct: 112 MYGVSAETIGVECRTVPTLDNW 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,266,049 Number of Sequences: 219361 Number of extensions: 352802 Number of successful extensions: 912 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)