| Clone Name | rbart51h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100 | 30 | 3.1 | 2 | WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein) | 29 | 4.0 | 3 | 5HTR_BOMMO (Q17239) 5-hydroxytryptamine receptor (5-HT receptor)... | 28 | 6.9 | 4 | DRD2A_XENLA (P24628) D(2) dopamine receptor A (D2R-A) (D2R 1) | 28 | 9.0 | 5 | VHR1_COWPX (P12932) Host range protein 1 | 28 | 9.0 |
|---|
>SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100| Length = 1038 Score = 29.6 bits (65), Expect = 3.1 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%) Frame = +1 Query: 55 LNQHTRTLKSCTSAAIYTRQMTPYIHMPVAGSWSRIKWDKMNDAIP------NYIYKC-- 210 +N H+R L+ TSA ++ + H+P+ + + +P I +C Sbjct: 314 MNCHSRYLRLTTSAIPNSQSLASRWHLPLGAVVCPLAETPEGEEVPLIDFGSTGIIRCRR 373 Query: 211 CRRLVNKNECVFYDAQRSWSCSALALL 291 CR VN F D+ R W C+ ++L Sbjct: 374 CRTYVNP-FVTFTDSGRKWRCNICSML 399
>WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein)| Length = 456 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 352 KQHRTWVCPSGGFKANFTHCKARPMLNKTSCAARRRRHIH 233 KQ C +G ++ HCK P C R+RRH+H Sbjct: 411 KQRSICKCRNGTCVSH-KHCKCHPGFYGRHCNGRKRRHVH 449
>5HTR_BOMMO (Q17239) 5-hydroxytryptamine receptor (5-HT receptor) (Serotonin| receptor) Length = 446 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 145 LLLACVYMVSFAVYI*LQMCSSSVCVCVDLDWNRIAPCEFRCI 17 +++ACV+ VSF V C + + D DWN+ + RC+ Sbjct: 179 MMIACVWTVSFFV------CIAQLLGWKDPDWNQRVSEDLRCV 215
>DRD2A_XENLA (P24628) D(2) dopamine receptor A (D2R-A) (D2R 1)| Length = 442 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 6 KKVYIHLNSQGAILFQSKSTHTHTEELHICSYIYTANDTIYTHASSRVVVQ 158 K+V NS+G + K TH E++ +CS +N + ++VQ Sbjct: 215 KRVNTKRNSRGVAVDAHKDKCTHPEDVKLCSVFVKSNGSFPADKKKVILVQ 265
>VHR1_COWPX (P12932) Host range protein 1| Length = 669 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 93 CSYIYTANDTIYTHASSRVVVQNQVGQNERCNTKLYLQMLS 215 CS IY D Y +A QN Q C T L+L ++S Sbjct: 162 CSVIYEDEDDEYGYAYEEYHSQNDDYQPRNCGTVLHLYIIS 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,081,763 Number of Sequences: 219361 Number of extensions: 1105249 Number of successful extensions: 2630 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2630 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)