| Clone Name | rbart51e01 |
|---|---|
| Clone Library Name | barley_pub |
>CER1_HUMAN (O95813) Cerberus precursor (Cerberus-related protein)| Length = 267 Score = 32.0 bits (71), Expect = 0.41 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 296 FNPGSDAMVEPLEEMVSDERPARYDAYNWGHFFSTRK 186 F PG+ ++++P++ M ++ P R +A + H F RK Sbjct: 105 FPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRK 141
>GAOX1_ORYSA (P93771) Gibberellin 20 oxidase 1 (EC 1.14.11.-) (Gibberellin C-20| oxidase 1) (GA 20-oxidase 1) (Os20ox) Length = 372 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAYNW 210 F P D +V P EE+V D P Y + W Sbjct: 306 FLCPEMDTVVRPPEELVDDHHPRVYPDFTW 335
>MATK_DROLU (Q5J2U8) Maturase K (Intron maturase)| Length = 514 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 227 YDAYNWGHFFSTRKNSNFKK 168 Y+++NW FFS +KN +F K Sbjct: 183 YESHNWNSFFSLKKNISFLK 202
>ACCO_PERAE (P19464) 1-aminocyclopropane-1-carboxylate oxidase (EC 1.14.17.4)| (ACC oxidase) (Ethylene-forming enzyme) (EFE) (Ripening-related protein PAVOE3) Length = 320 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAY 216 F+NPGSDA++ P +V E + + Y Sbjct: 251 FYNPGSDAVIFPAPALVEKEAEEKKEVY 278
>ACCO_DENCR (Q9ZQZ1) 1-aminocyclopropane-1-carboxylate oxidase (EC 1.14.17.4)| (ACC oxidase) (Ethylene-forming enzyme) (EFE) Length = 318 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDE 240 F+NPGSDA++ P E+V E Sbjct: 248 FYNPGSDAVIFPAPELVEKE 267
>ACCO1_ORYSA (Q40634) 1-aminocyclopropane-1-carboxylate oxidase 1 (EC 1.14.17.4)| (ACC oxidase 1) (Ethylene-forming enzyme) (EFE) Length = 322 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDE 240 F+NPGSDA++ P +V +E Sbjct: 256 FYNPGSDAVISPAPALVKEE 275
>YR224_MIMIV (Q5UQB7) Putative BTB/POZ domain-containing protein R224| Length = 540 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 99 ESAKIHSKVELSEVCDLYVFDV 164 E + IH+K+ VCD+YV+D+ Sbjct: 206 EFSSIHNKIIYHHVCDIYVYDL 227
>ACCO_PRUMU (Q9MB94) 1-aminocyclopropane-1-carboxylate oxidase (EC 1.14.17.4)| (ACC oxidase) (Ethylene-forming enzyme) (EFE) Length = 319 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAY 216 F+NPGSDA++ P +V E + Y Sbjct: 250 FYNPGSDAVIYPAPTLVEKEAEEKNQVY 277
>ACCO1_LYCES (P05116) 1-aminocyclopropane-1-carboxylate oxidase 1 (EC 1.14.17.4)| (ACC oxidase 1) (Ethylene-forming enzyme) (EFE) (Protein pTOM 13) Length = 315 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAY 216 F+NPGSDA++ P + +V E Y Sbjct: 250 FYNPGSDAVIYPAKTLVEKEAEESTQVY 277
>ACCO_ACTCH (P31237) 1-aminocyclopropane-1-carboxylate oxidase (EC 1.14.17.4)| (ACC oxidase) (Ethylene-forming enzyme) (EFE) Length = 319 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAY 216 F+NPGSDA++ P +V E + Y Sbjct: 250 FYNPGSDAVMYPAPALVDKEEDQQKQVY 277
>ACCO1_PETHY (Q08506) 1-aminocyclopropane-1-carboxylate oxidase 1 (EC 1.14.17.4)| (ACC oxidase 1) (Ethylene-forming enzyme) (EFE) Length = 319 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 299 FFNPGSDAMVEPLEEMVSDERPARYDAY 216 F+NPGSDA++ P +V E Y Sbjct: 250 FYNPGSDAVIYPAPALVEKEAEENKQVY 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,307,351 Number of Sequences: 219361 Number of extensions: 421537 Number of successful extensions: 1170 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)