ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart51d11 |
|---|---|
| Clone Library Name | barley_pub |
>PMGI_MAIZE (P30792) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 362 QTPGLANVAATVMNLHGFQAPADYETTLIEVVD 264 QTPGLANVAATVMNLHGF+APADYE TLIEV D Sbjct: 526 QTPGLANVAATVMNLHGFEAPADYEQTLIEVAD 558
>PMG2_ARATH (Q9M9K1) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase 2 (EC 5.4.2.1) (Phosphoglyceromutase 2) (BPG-independent PGAM 2) (PGAM-I 2) Length = 560 Score = 63.2 bits (152), Expect = 2e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 362 QTPGLANVAATVMNLHGFQAPADYETTLIEVVDK 261 +TPGLANVAATVMNLHGF AP+DYET+LIEVV+K Sbjct: 527 ETPGLANVAATVMNLHGFVAPSDYETSLIEVVEK 560
>PMGI_PRUDU (O24246) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) (Fragment) Length = 488 Score = 61.6 bits (148), Expect = 4e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 353 GLANVAATVMNLHGFQAPADYETTLIEVVD 264 GLANVAATVMNLHGF+APADYETTLIEVVD Sbjct: 458 GLANVAATVMNLHGFEAPADYETTLIEVVD 487
>PMG1_ARATH (O04499) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase 1 (EC 5.4.2.1) (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (PGAM-I 1) Length = 557 Score = 60.5 bits (145), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 362 QTPGLANVAATVMNLHGFQAPADYETTLIEVVD 264 +TPGLANVAATVMNLHGF AP+DYE TLIEVV+ Sbjct: 525 ETPGLANVAATVMNLHGFVAPSDYEPTLIEVVE 557
>PMGI_RICCO (P35493) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 556 Score = 57.8 bits (138), Expect = 6e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 359 TPGLANVAATVMNLHGFQAPADYETTLIEVVD 264 T GLANVAATVMNLHGF+AP+DYE TLIE VD Sbjct: 524 TGGLANVAATVMNLHGFEAPSDYEPTLIEAVD 555
>PMGI_MESCR (Q42908) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 359 TPGLANVAATVMNLHGFQAPADYETTLIEVV 267 T GLANVAATVMNLHGF+AP+DYE TLIEVV Sbjct: 527 TGGLANVAATVMNLHGFEAPSDYEPTLIEVV 557
>PMGI_TOBAC (P35494) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (PGAM-I) Length = 559 Score = 52.8 bits (125), Expect = 2e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 359 TPGLANVAATVMNLHGFQAPADYETTLIEVVD 264 T GLANVAAT MNLHG +AP+DYE +LIEVVD Sbjct: 527 TGGLANVAATFMNLHGSEAPSDYEPSLIEVVD 558
>GPMI_LEPIN (P59173) Probable 2,3-bisphosphoglycerate-independent| phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 552 Score = 36.2 bits (82), Expect = 0.020 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = -1 Query: 356 PGLANVAATVMNLHGFQAPADYETTLIE 273 PGLANVAAT++++ G++ P Y +LI+ Sbjct: 522 PGLANVAATILDVMGYETPEGYHPSLIQ 549
>GPMI_LEPIC (Q72VB8) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 552 Score = 36.2 bits (82), Expect = 0.020 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = -1 Query: 356 PGLANVAATVMNLHGFQAPADYETTLIE 273 PGLANVAAT++++ G++ P Y +LI+ Sbjct: 522 PGLANVAATILDVMGYETPEGYHPSLIQ 549
>YOPB_YERPS (Q06114) Protein yopB| Length = 401 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 224 GSQFCRYSFGVGQGMIASLNNLRFASTLAQNSCVTLRKVD 105 GSQ + + GVG G+ ++NN + A N+ + L K D Sbjct: 312 GSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKAD 351
>YOPB_YEREN (P37131) Protein yopB| Length = 401 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 224 GSQFCRYSFGVGQGMIASLNNLRFASTLAQNSCVTLRKVD 105 GSQ + + GVG G+ ++NN + A N+ + L K D Sbjct: 312 GSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKAD 351
>Y1616_YERPE (Q8ZFS2) UPF0227 protein YPO1616/y1776/YP2238| Length = 180 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 132 LMCNIEKGGFYLQ-LALFCNLGCHAGWLNRQIAFFANLYPRD 10 L+C + GGF+ + + C + RQ+AF NLYP++ Sbjct: 63 LICGVGLGGFWAERIGFLCGI--------RQVAFNPNLYPQE 96
>SGCC_ECOLI (P39365) Putative permease IIC component (Putative PTS system EIIC| component) Length = 437 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 237 SESAVVFLLVDD-FDEGRLVIGRSLEAMEVHHRGGNVGEP 353 S S +F+L+D +++ + GR+++A E+ R G VG+P Sbjct: 181 SSSVPLFVLLDAIYEKIPFMKGRNIDAQEIQKRYGMVGDP 220
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 245 AL*SQNCGSQFCRYSFGVGQG 183 AL S C + FC+Y++G G G Sbjct: 157 ALSSPTCSNNFCQYTYGYGDG 177
>NHR22_CAEEL (Q09587) Nuclear hormone receptor family member nhr-22| Length = 579 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 7/29 (24%) Frame = +2 Query: 110 PFSMLHMSFEQ-------VCWQISNYSMM 175 PF+ L +SFE+ + WQISNY ++ Sbjct: 472 PFARLEVSFEEYVLLKALIIWQISNYRLL 500
>YHV5_YEAST (P38851) Hypothetical 143.6 kDa protein in SPO16-REC104 intergenic| region Length = 1228 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = +1 Query: 1 QDEIPGV*ISKKRYLSVKPTRVATQVTK*S*LQVKSTFLNVTHEF*ASVLAN 156 +D+I + +K +L V T +ATQ+T L + STFL+V++ + + AN Sbjct: 481 EDDIYSIIDNKAYHLRVISTPIATQLTH---LALFSTFLSVSNYYPCATQAN 529 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,389,107 Number of Sequences: 219361 Number of extensions: 976281 Number of successful extensions: 2207 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2207 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
