Clone Name | rbart51d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC ... | 31 | 0.80 | 2 | UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (E... | 29 | 2.3 | 3 | RS4E_THEVO (Q97BW4) 30S ribosomal protein S4e | 28 | 6.8 | 4 | FIMB_SCHPO (O59945) Fimbrin | 27 | 8.8 | 5 | HUT1_SCHPO (Q8WZJ9) UDP-galactose transporter homolog 1 | 27 | 8.8 | 6 | Y4142_BRAJA (Q89MQ0) UPF0061 protein bll4142 | 27 | 8.8 |
---|
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 30.8 bits (68), Expect = 0.80 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 171 VSKEGGVCFWCPKTSLCQPCFIIIAPDK 254 V K+G C WCP+ C+ C I D+ Sbjct: 958 VQKDGNSCAWCPQYRFCRGCKIDCGEDR 985
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 171 VSKEGGVCFWCPKTSLCQPCFIIIAPDK 254 V K+G C WCP C+ C I D+ Sbjct: 1160 VQKDGNSCAWCPWYRFCRGCKIDCGEDR 1187
>RS4E_THEVO (Q97BW4) 30S ribosomal protein S4e| Length = 235 Score = 27.7 bits (60), Expect = 6.8 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = -3 Query: 189 LPLLLKPFHSHRILTALSWMVILLSDNQRSSTTILGADLVKEDG 58 LP K HS +LT + + LSD +R +T IL LVK DG Sbjct: 28 LPGRHKADHSVTLLTIIR-DYLRLSDKEREATRILANGLVKVDG 70
>FIMB_SCHPO (O59945) Fimbrin| Length = 614 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 58 TIFFHQISPQNCSRAPLVITQQNDHPRQSRQYSVRM 165 T+ +Q++P+ CSRAPL T Q Q + ++ Sbjct: 298 TVLLNQLAPELCSRAPLQTTDVLQRAEQVLQNAEKL 333
>HUT1_SCHPO (Q8WZJ9) UDP-galactose transporter homolog 1| Length = 322 Score = 27.3 bits (59), Expect = 8.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 201 TKNTLPLLLKPFHSHRILTALSWMVILL 118 T+ +LL FH H ++++ W+ ILL Sbjct: 270 TRKIFTMLLSVFHFHHTVSSIQWLGILL 297
>Y4142_BRAJA (Q89MQ0) UPF0061 protein bll4142| Length = 491 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 20 LRFAFDRSYNLAPPSSFTRSAPKIVVELLWLSLNR 124 + F F SY+ P S F R AP V + LNR Sbjct: 3 VHFPFQNSYSALPDSFFARVAPTPVAAPRLIKLNR 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,890,536 Number of Sequences: 219361 Number of extensions: 1203705 Number of successful extensions: 2568 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2568 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)