| Clone Name | rbart51b01 |
|---|---|
| Clone Library Name | barley_pub |
>CBLBA_XENLA (Q6GQL0) E3 ubiquitin-protein ligase CBL-B-A (EC 6.3.2.-) (Signal| transduction protein CBL-B-A) (SH3-binding protein CBL-B-A) Length = 918 Score = 32.7 bits (73), Expect = 0.23 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 224 PPDARQCKHVNHRDTSPC 277 PPD+R C+H++H D PC Sbjct: 575 PPDSRTCRHLHHADNVPC 592
>CBLBB_XENLA (Q6NRE7) E3 ubiquitin-protein ligase CBL-B-B (EC 6.3.2.-) (Signal| transduction protein CBL-B-B) (SH3-binding protein CBL-B-B) Length = 764 Score = 31.2 bits (69), Expect = 0.67 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 224 PPDARQCKHVNHRDTSPC 277 PPD+R C+H++H + PC Sbjct: 577 PPDSRTCRHLHHAENVPC 594
>CBLB_XENTR (Q6DFR2) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) Length = 982 Score = 31.2 bits (69), Expect = 0.67 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 224 PPDARQCKHVNHRDTSPC 277 PPD+R C+H++H + PC Sbjct: 575 PPDSRTCRHLHHTENVPC 592
>SIM1_HUMAN (P81133) Single-minded homolog 1| Length = 766 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 218 QPPPDARQCKHVNHRDTSPCDH 283 QPPP C +TSPCDH Sbjct: 611 QPPPTGEVCHGSALANTSPCDH 632
>SIM1_MOUSE (Q61045) Single-minded homolog 1 (mSIM1)| Length = 765 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 218 QPPPDARQCKHVNHRDTSPCDH 283 QPPP C TSPCDH Sbjct: 610 QPPPTGEVCHSSALASTSPCDH 631
>YNJ7_YEAST (P50947) Hypothetical 37.0 kDa protein in RAS2-RPS7B intergenic| region Length = 330 Score = 27.3 bits (59), Expect = 9.6 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 54 PAIHFSLHAPSNYRGIMSRNKNKSNQKDQQPLKSEQKR 167 PA+H + +M + ++KSN K Q LKSE +R Sbjct: 129 PAMHL-------HHELMEKIESKSNSKSSQALKSESRR 159
>SND1_BRARE (Q7ZT42) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (4SNc-Tudor domain protein) Length = 897 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +3 Query: 30 VALHKNVTPAIHFSLHAPSNYRGIMSRNKNKSNQKDQQPLKSEQKRSTCVDLALRAHRIG 209 VAL +N +HF+ S Y+ ++S ++ +K++ E+K + V A G Sbjct: 623 VALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWANYEEKPNEEVAQVTEAKERG 682 Query: 210 R 212 R Sbjct: 683 R 683
>CD2_RAT (P08921) T-cell surface antigen CD2 precursor (T-cell surface| antigen T11/Leu-5) (LFA-2) (LFA-3 receptor) (OX-34 antigen) Length = 344 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +2 Query: 119 QIKPKRPTTFEK*AKKIDVRGSSPQGS*DRALSQPPPDARQCKHVNHRDTSP 274 +IK R +T E+ K + S+P A PPP + HR P Sbjct: 243 EIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPP 294
>ZN396_HUMAN (Q96N95) Zinc finger protein 396 (Zinc finger and SCAN| domain-containing protein 14) Length = 335 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +3 Query: 30 VALHKNVTPAIHFSLHAPSNYRGIMSRNKNKSNQKDQQPLKSEQKRSTC 176 + LH NV+ +H + S YRG ++ ++ K +QK C Sbjct: 208 IELHCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQQKCDEC 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,478,274 Number of Sequences: 219361 Number of extensions: 626656 Number of successful extensions: 1357 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1357 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)