Clone Name | rbart51a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrin... | 35 | 0.038 | 2 | LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12) | 28 | 7.8 | 3 | LOX1_ARATH (Q06327) Lipoxygenase 1 (EC 1.13.11.12) | 28 | 7.8 |
---|
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 35.4 bits (80), Expect = 0.038 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 287 ICFIGQRPHEQLPTAEY 237 I FIGQRPH+QLPTA+Y Sbjct: 236 IIFIGQRPHDQLPTADY 252
>LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12)| Length = 861 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 12 NLDHGIEAFITEDAHQDKRLFLTDSHTVYPEFLK 113 +L+ +E E+A Q+K+LFL D H +L+ Sbjct: 409 HLEPNLEGLTVEEAIQNKKLFLLDHHDSIMPYLR 442
>LOX1_ARATH (Q06327) Lipoxygenase 1 (EC 1.13.11.12)| Length = 859 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 3 TNINLDHGIEAFITEDAHQDKRLFLTDSHTVYPEFL 110 T +++H ++ E+A + +RLF+ D H +L Sbjct: 404 TKSHIEHNLDGLTVEEALEKERLFILDHHDTLMPYL 439 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,569,566 Number of Sequences: 219361 Number of extensions: 462030 Number of successful extensions: 835 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)