Clone Name | rbart51a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PTG3C_BACSU (P20166) PTS system glucose-specific EIICBA componen... | 28 | 5.5 | 2 | UL88_HHV7J (P52364) Protein U59 | 27 | 9.3 | 3 | MRJP1_APIME (O18330) Major royal jelly protein 1 precursor (MRJP... | 27 | 9.3 |
---|
>PTG3C_BACSU (P20166) PTS system glucose-specific EIICBA component (EIICBA-Glc)| (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (EC 2.7.1.6 Length = 699 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 219 QFYYGPNAGDGFCYLQSEVFSMQTVRPEVVHYNSTMH-IKVQAESAR 82 Q + G GDGF L SE + VR ++++ T H I +Q++ R Sbjct: 569 QVFSGKMMGDGFAILPSEGIVVSPVRGKILNVFPTKHAIGLQSDGGR 615
>UL88_HHV7J (P52364) Protein U59| Length = 347 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 183 CYLQSEVFSMQTVRPEVVHYNSTMHIKVQA 94 C L + ++S +T+ PE+V ++H+ V+A Sbjct: 257 CTLLNSIYSYKTLLPEIVDNTRSIHVVVKA 286
>MRJP1_APIME (O18330) Major royal jelly protein 1 precursor (MRJP-1) (Bee-milk| protein) [Contains: Jellein-1 (Jelleine-I); Jellein-2 (Jelleine-II); Jellein-4 (Jelleine-IV)] Length = 432 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -3 Query: 213 YYGPNAGDGFCYLQSEVFSMQTVRPEVVHYNSTMHIKVQAESARI 79 YY P A Y+ +E F + +HY +I SA++ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKV 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,782,532 Number of Sequences: 219361 Number of extensions: 461182 Number of successful extensions: 912 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)