ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart51a04 |
|---|---|
| Clone Library Name | barley_pub |
>TCMO_PETCR (Q43033) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 506 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T EK GQFS QILKH+TIVCKP Sbjct: 482 TAEKGGQFSLQILKHSTIVCKP 503
>TCMO_CICAR (O81928) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T EK GQFS ILKH+TIVCKP Sbjct: 480 TAEKGGQFSLHILKHSTIVCKP 501
>TCMO_ZINEL (Q43240) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 36.6 bits (83), Expect = 0.017 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 TTEK GQFS ILKH+TIV KP Sbjct: 481 TTEKGGQFSLHILKHSTIVAKP 502
>TCMO_SOYBN (Q42797) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 506 Score = 35.0 bits (79), Expect = 0.049 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 482 TSEKGGQFSLHILKHSTIVAKP 503
>TCMO_POPTM (O24312) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 35.0 bits (79), Expect = 0.049 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 481 TSEKGGQFSLHILKHSTIVAKP 502
>TCMO_POPKI (Q43054) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 35.0 bits (79), Expect = 0.049 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 481 TSEKGGQFSLHILKHSTIVAKP 502
>TCMO_PEA (Q43067) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 35.0 bits (79), Expect = 0.049 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 481 TSEKGGQFSLHILKHSTIVAKP 502
>TCMO_MEDSA (P37114) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 506 Score = 35.0 bits (79), Expect = 0.049 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 482 TSEKGGQFSLHILKHSTIVAKP 503
>TCMO_PHAAU (P37115) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 34.7 bits (78), Expect = 0.063 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+T+V KP Sbjct: 481 TSEKGGQFSLHILKHSTVVAKP 502
>TCMO_GLYEC (Q96423) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 34.7 bits (78), Expect = 0.063 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T EK GQFS ILKH+TIV KP Sbjct: 481 TAEKGGQFSLHILKHSTIVAKP 502
>TCMO_CATRO (P48522) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 34.7 bits (78), Expect = 0.063 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS ILKH+TIV KP Sbjct: 481 TSEKGGQFSLHILKHSTIVLKP 502
>TCMO_HELTU (Q04468) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 34.3 bits (77), Expect = 0.083 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T EK GQFS ILKH+TIV KP Sbjct: 481 TDEKGGQFSLHILKHSTIVAKP 502
>TCMO_RUTGR (Q9AR74) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 506 Score = 31.6 bits (70), Expect = 0.54 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS IL H+TIV KP Sbjct: 481 TSEKGGQFSLFILNHSTIVLKP 502
>SMCL_ARATH (Q8VY05) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily C member (AtSwi3C) Length = 985 Score = 31.2 bits (69), Expect = 0.70 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -1 Query: 266 PDPQARHHRLQATRGLIEFRSRSCAYADAGRSIYAC----DSVFCILVFHSSKFN 114 PDP A L+ +E+ SC+ AD R Y C D C F+S KF+ Sbjct: 290 PDPMAADELLKQEGPAVEYHCNSCS-ADCSRKRYHCPKQADFDLCTECFNSGKFS 343
>TCMO_ARATH (P92994) Trans-cinnamate 4-monooxygenase (EC 1.14.13.11) (Cinnamic| acid 4-hydroxylase) (CA4H) (C4H) (P450C4H) (Cytochrome P450 73) Length = 505 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 295 TTEKPGQFSNQILKHATIVCKP 230 T+EK GQFS IL H+ IV KP Sbjct: 481 TSEKGGQFSLHILNHSIIVMKP 502
>POLG_DEN2U (P18356) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 679 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +3 Query: 123 TTVKHQNAKYRVTCIDRSPRISVRA*PRSELNQASSGLQTMVACLRIWLLNCPGFSVV 296 TT +H+ K V + P + + R+E +S G + IW+L PGF+++ Sbjct: 96 TTGEHRREKRSVALV---PHVGMGLETRTETWMSSEGAWKHAQRIEIWILRHPGFTIM 150
>POLG_DEN2J (P07564) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3391 Score = 28.9 bits (63), Expect = 3.5 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +3 Query: 123 TTVKHQNAKYRVTCIDRSPRISVRA*PRSELNQASSGLQTMVACLRIWLLNCPGFSVV 296 TT +H+ K V + P + + R+E +S G V + W+L PGF+++ Sbjct: 196 TTGEHRREKRSVALV---PHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPGFTIM 250
>CEP72_HUMAN (Q9P209) Centrosomal protein of 72 kDa (Cep72 protein)| Length = 647 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +2 Query: 182 HQRTRMTEI*TQSSLEWLADDGGVLEDLVAELPWLLG 292 H R + TE + SL ADD VL +L+AE W LG Sbjct: 174 HPRAKCTEALAKQSLVMDADDEAVL-NLIAECEWDLG 209
>VE5_HPV18 (P06792) Probable protein E5| Length = 73 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -2 Query: 127 VVSLIFLWCWAICLHLRRRCCKFP 56 ++SLIFL+C+ +C+++ CC P Sbjct: 1 MLSLIFLFCFCVCMYV---CCHVP 21
>AEGA_ECOLI (P37127) Protein aegA| Length = 659 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = +3 Query: 93 IAQHQRKIKLTTVKHQNAKYRVTCIDRSPRISVRA*PRSELNQASSGLQ 239 ++QH ++T +KHQ + VTC R+ P ++ +Q Sbjct: 33 LSQHHFHPRITVIKHQQQRSAVTCHHCEDAPCARSCPNGAISHVDDSIQ 81
>TRM10_YEAST (Q12400) tRNA (guanine-N(1)-)-methyltransferase TRM10 (EC 2.1.1.31)| (tRNA methyltransferase 10) Length = 293 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 105 QRKIKLTTVKHQNAKYRVTCIDRS---PRISVRA*PRSELNQASSGLQTMVACLRIWLLN 275 +R++K ++H+ + IDR P+ +R PR +NQ SG++ ++ C L+N Sbjct: 50 ERRVKKKRLRHERSAKIQEYIDRGEEVPQELIRE-PRINVNQTDSGIEIILDCSFDELMN 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,988,282 Number of Sequences: 219361 Number of extensions: 689803 Number of successful extensions: 1987 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1986 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
