Clone Name | rbart50h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YR692_MIMIV (Q5UNV0) Hypothetical protein R692 | 33 | 0.28 | 2 | NHX3_ARATH (Q84WG1) Sodium/hydrogen exchanger 3 (Na(+)/H(+) exch... | 28 | 6.9 |
---|
>YR692_MIMIV (Q5UNV0) Hypothetical protein R692| Length = 354 Score = 33.1 bits (74), Expect = 0.28 Identities = 13/41 (31%), Positives = 27/41 (65%) Frame = +2 Query: 26 SISAQRKANKSARLRVAYN*SISNRVKTHSSNVPPQTGGKN 148 ++S+Q AN++A + YN S+++ +++N QTGG++ Sbjct: 288 NVSSQNNANRNASMATTYNNSVNSANSINTANTRSQTGGQD 328
>NHX3_ARATH (Q84WG1) Sodium/hydrogen exchanger 3 (Na(+)/H(+) exchanger 3)| (NHE-3) Length = 503 Score = 28.5 bits (62), Expect = 6.9 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 7/41 (17%) Frame = -2 Query: 137 LFEEARWMNEFLPC*ILISCRLPVVLRI-------CLLFSE 36 L EE RWMNE + I+ SC V+L I L+FSE Sbjct: 42 LLEETRWMNESITALIIGSCTGIVILLISGGKSSRILVFSE 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,873,821 Number of Sequences: 219361 Number of extensions: 622408 Number of successful extensions: 1596 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1596 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)