Clone Name | rbart50h05 |
---|---|
Clone Library Name | barley_pub |
>M2OM_MOUSE (Q9CR62) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 GK Y LD ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 254 GKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>M2OM_BOVIN (P22292) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 GK Y LD ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 254 GKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>OAC1_YEAST (P32332) Mitochondrial oxaloacetate transport protein| (Mitochondrial carrier protein PMT) Length = 324 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 Y G +DC ++T++ G Y GF RIAPH +M F+ Sbjct: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
>DIC_HUMAN (Q9UBX3) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = -3 Query: 354 KYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 K Y G CA++T K G P FY G +R+ PH ++T++FL Sbjct: 231 KGEYQGVFHCAVETAKLG-PLAFYKGLVPAGIRLIPHTVLTFVFL 274
>M2OM_HUMAN (Q02978) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 GK Y LD + ++ G F + GF Y R+ PH ++T++FL Sbjct: 254 GKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>M2OM_RAT (P97700) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 37.0 bits (84), Expect = 0.011 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -3 Query: 354 KYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 K Y LD ++ ++ G F + GF Y R+ PH ++T++FL Sbjct: 255 KPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL 299
>DIC_MOUSE (Q9QZD8) Mitochondrial dicarboxylate carrier (Solute carrier family| 25 member 10) Length = 287 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = -3 Query: 354 KYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLFL 220 K Y G CAM+T K G P F+ G +R+ PH ++T++FL Sbjct: 230 KGEYQGVFHCAMETAKLG-PQAFFKGLFPAGIRLIPHTVLTFMFL 273
>DIF1_CAEEL (Q27257) Protein dif-1| Length = 312 Score = 32.7 bits (73), Expect = 0.22 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 387 QIQKMQPDATGKYP-YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 +IQ M G+ P +TG+LDC +T+ G F Y G V ++P Sbjct: 31 RIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFALYKGMAAPLVGVSP 78
>COLT_DROME (Q9VQG4) Congested-like trachea protein| Length = 306 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 387 QIQKMQPDATGKYP-YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++Q M A G+ P Y G+ DCA +T+K G Y G +AP Sbjct: 42 RLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAP 89
>ADT_CHLKE (P31692) ADP,ATP carrier protein (ADP/ATP translocase) (Adenine| nucleotide translocator) (ANT) Length = 339 Score = 32.0 bits (71), Expect = 0.37 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPV 268 +TG +DC + +K GGP Y GF V Sbjct: 187 FTGLVDCLSKVVKRGGPMALYQGFGV 212
>CMC1_CAEEL (Q21153) Probable calcium-binding mitochondrial carrier K02F3.2| Length = 707 Score = 31.2 bits (69), Expect = 0.63 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWL 226 G+ Y G +DCA + +K GP + G R +P +T L Sbjct: 596 GQTTYNGVIDCARKLIKEEGPMSLWKGTAARVCRSSPQFAVTLL 639 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 Q Q+ G+ Y SLDC + +K G Y G V +AP Sbjct: 398 QNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIVGVAP 444
>TXTP_CAEEL (P34519) Putative tricarboxylate transport protein, mitochondrial| precursor (Citrate transport protein) (CTP) Length = 312 Score = 31.2 bits (69), Expect = 0.63 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWL 226 Y +LDCAMQ K G F FY G R+ V +T++ Sbjct: 256 YKNTLDCAMQIWKKEGFFAFYKGTVPRLSRVCLDVGITFM 295
>UCP4_HUMAN (O95847) Mitochondrial uncoupling protein 4 (UCP 4) (Solute carrier| family 25 member 27) Length = 323 Score = 30.8 bits (68), Expect = 0.82 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWL 226 Y S DC +Q ++ G Y GF +R+ P M+ WL Sbjct: 270 YKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWL 309
>GHC2_HUMAN (Q9H1K4) Mitochondrial glutamate carrier 2 (GC-2) (Glutamate/H(+)| symporter 2) (Solute carrier family 25 member 18) Length = 315 Score = 30.8 bits (68), Expect = 0.82 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 GK Y G +DC M+T + G F Y G V + P Sbjct: 41 GKAMYKGMIDCLMKTARAEGFFGMYRGAAVNLTLVTP 77
>RIM2_YEAST (P38127) Mitochondrial carrier protein RIM2| Length = 377 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -3 Query: 378 KMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMM---TW 229 + P GK YTG + +K G F YSG + +R P+ ++ TW Sbjct: 317 RQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTW 369
>GHC1_PONPY (Q5RD81) Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+)| symporter 1) (Solute carrier family 25 member 22) Length = 323 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -3 Query: 378 KMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++Q G+ YT DC ++T+++ G F Y G V + P Sbjct: 35 RLQNQQNGQRMYTSMSDCLIKTIRSEGYFGMYRGAAVNLTLVTP 78 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 Y+G LDCA + ++ GP F G + IAP Sbjct: 265 YSGILDCARKILRHEGPSAFLKGAYCRALVIAP 297
>GHC1_HUMAN (Q9H936) Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+)| symporter 1) (Solute carrier family 25 member 22) Length = 323 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -3 Query: 378 KMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++Q G+ YT DC ++T+++ G F Y G V + P Sbjct: 35 RLQNQQNGQRVYTSMSDCLIKTVRSEGYFGMYRGAAVNLTLVTP 78 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 Y+G LDCA + ++ GP F G + IAP Sbjct: 265 YSGILDCARKILRHEGPSAFLKGAYCRALVIAP 297
>TXTP_RAT (P32089) Tricarboxylate transport protein, mitochondrial precursor| (Citrate transport protein) (CTP) (Tricarboxylate carrier protein) (Solute carrier family 25 member 1) Length = 311 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 351 YPYTGSLDCAMQTMKTGGPFKFYSG 277 + Y +LDC +Q +K GP FY G Sbjct: 254 HKYRNTLDCGVQILKNEGPKAFYKG 278
>MCAT_RAT (P97521) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (Solute carrier family 25 member 20) Length = 301 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 363 ATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++GK Y+G+LDCA + + G FY G + +R P Sbjct: 143 SSGKNKYSGTLDCAKKLYQEFGIRGFYKGTALTLMRDVP 181
>MCAT_MOUSE (Q9Z2Z6) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (mCAC) (Solute carrier family 25 member 20) Length = 301 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 387 QIQKMQPDATGKYP-YTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++Q P +G+ P Y+G+LDC +T+ G Y G + + P Sbjct: 37 RLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTP 84 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 363 ATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++G+ Y+G+LDCA + + G FY G + +R P Sbjct: 143 SSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVP 181
>COX18_YEAST (P53239) Inner membrane protein COX18, mitochondrial precursor| (Cytochrome c oxidase assembly protein 18) Length = 316 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 173 SWRQYQSLLDTFNNFSAALHLPWLFLV 93 S+ +QS+ DTF A H+PW+ LV Sbjct: 34 SFSLFQSVADTFLTVHEASHIPWIVLV 60
>Y2143_SHEON (Q8EF50) Hypothetical transport protein SO2143| Length = 562 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 277 AGVELKWATSLHGLHGTVQRPSVWVLSS 360 AG+ W S H G V P+VW ++S Sbjct: 423 AGLIFSWVRSFHPTFGWVPEPTVWFMNS 450
>ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2948 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 32 NNVKSTTANVSYGKNCLKLCLPKTTTGDAKLLKS 133 N S +SYG NCLKL + K+ + +L S Sbjct: 64 NKASSAEFRLSYGSNCLKLLIEKSLDYNQELRNS 97
>CMC1_PONPY (Q5RBC8) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMT 232 G+ Y+G +DC + ++ GP F+ G R +P +T Sbjct: 553 GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVT 594
>CMC1_HUMAN (O75746) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 678 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMT 232 G+ Y+G +DC + ++ GP F+ G R +P +T Sbjct: 553 GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVT 594
>UCP1_RABIT (P14271) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -3 Query: 378 KMQPDATGKYP------YTGSLDCAMQTMKTGGPFKFYSGFP 271 K++ G++P Y G L KT GP K YSG P Sbjct: 38 KVRQQIQGEFPITSGIRYKGVLGTITTLAKTEGPLKLYSGLP 79
>GHC1_MOUSE (Q9D6M3) Mitochondrial glutamate carrier 1 (GC-1) (Glutamate/H(+)| symporter 1) (Solute carrier family 25 member 22) Length = 323 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -3 Query: 378 KMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++Q G+ Y DC ++T+++ G F Y G V + P Sbjct: 35 RLQNQQNGQRMYASMSDCLIKTIRSEGYFGMYRGAAVNLTLVTP 78
>ADT2_RAT (Q09073) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLF 223 Q+Q T Y G +DC ++ K G F+ G +R P + + F Sbjct: 36 QVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAF 90
>ADT2_MOUSE (P51881) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLF 223 Q+Q T Y G +DC ++ K G F+ G +R P + + F Sbjct: 36 QVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAF 90
>ADT2_HUMAN (P05141) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) (ADP,ATP carrier protein, fibroblast isoform) Length = 297 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLF 223 Q+Q T Y G +DC ++ K G F+ G +R P + + F Sbjct: 36 QVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAF 90
>ADT2_BOVIN (Q8SQH5) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLF 223 Q+Q T Y G +DC ++ K G F+ G +R P + + F Sbjct: 36 QVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAF 90
>RS11_MYCPN (Q50296) 30S ribosomal protein S11| Length = 121 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +3 Query: 135 IKCVEQGLILS---PTGDLICRSSSGTSGFDSRRATSS*HAG 251 + C I+S P G+++C +SSGT GF R + AG Sbjct: 16 VSCSPNNTIVSASDPGGNVLCWASSGTMGFKGSRKKTPYSAG 57
>RR11_CYAPA (P48136) Cyanelle 30S ribosomal protein S11| Length = 130 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 159 ILSPTGDLICRSSSGTSGFDSRR 227 I SPTG++I +S+G+SGF R Sbjct: 35 ITSPTGEVIAWASAGSSGFKGAR 57
>MCAT_MACFA (Q8HXY2) Mitochondrial carnitine/acylcarnitine carrier protein| (Carnitine/acylcarnitine translocase) (CAC) (Solute carrier family 25 member 20) Length = 301 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 363 ATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAP 247 ++G+ YTG+LDCA + + G Y G V +R P Sbjct: 143 SSGETKYTGTLDCAKKLYQEFGIRGIYKGTVVTLMRDVP 181
>ADT1_ANOGA (Q27238) ADP,ATP carrier protein 1 (ADP/ATP translocase 1) (Adenine| nucleotide translocator 1) (ANT 1) Length = 301 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPV 268 G+ + G LDC +T+K+ G Y GF V Sbjct: 152 GEREFNGLLDCLKKTVKSDGIIGLYRGFNV 181
>GLGA_RHORT (Q2RS50) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 485 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -3 Query: 357 GKYPYTGS----LDCAMQTMKTGGPFKFYSG 277 G P TG LDC +TGGP+ YSG Sbjct: 74 GTMPDTGCPLWLLDCPAMYERTGGPYMMYSG 104
>Y736_BACTN (Q8A9S9) Hypothetical transport protein BT_0736| Length = 564 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 277 AGVELKWATSLHGLHGTVQRPSVWVLSS 360 AG+ W S H G + PS+WVL++ Sbjct: 426 AGLVFGWLRSKHPTFGGIPEPSLWVLNN 453
>RS11_MYCGE (P47422) 30S ribosomal protein S11| Length = 131 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +3 Query: 135 IKCVEQGLILS---PTGDLICRSSSGTSGFDSRRATSS*HAG 251 + C I+S P+G+++C +SSGT GF R + AG Sbjct: 16 VSCSPNNTIVSATDPSGNVLCWASSGTVGFKGFRKKTPYSAG 57
>CMC1_MOUSE (Q8BH59) Calcium-binding mitochondrial carrier protein Aralar1| (Mitochondrial aspartate glutamate carrier 1) (Solute carrier family 25 member 12) Length = 677 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -3 Query: 357 GKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMT 232 G+ Y+G +DC + ++ GP F+ G R +P +T Sbjct: 553 GQTTYSGVVDCFRKILREEGPSAFWKGTAARVFRSSPQFGVT 594
>RIR1_DROME (P48591) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleoside-diphosphate reductase M1 subunit) (Ribonucleotide reductase large chain) Length = 812 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 345 YTGSLDCAMQTMKTGGPFKFYSGFPV 268 Y G+L+ + + +T GP++ Y G PV Sbjct: 547 YYGALEASCELAQTEGPYETYEGSPV 572
>TAP1_HUMAN (Q03518) Antigen peptide transporter 1 (APT1) (Peptide transporter| TAP1) (ATP-binding cassette sub-family B member 2) (Peptide transporter PSF1) (Peptide supply factor 1) (PSF-1) (Peptide transporter involved in antigen processing 1) Length = 748 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = -2 Query: 283 LRLSSILCQDRPACHDDVALLESNPEVPEEDRHIRSPVGDSINPCSTHLITFQQLCISRG 104 L++ +L + V L+ + + E+ HI G +I TH QQL +G Sbjct: 679 LQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTH----QQLMEKKG 734 Query: 103 CFW 95 C+W Sbjct: 735 CYW 737
>TAP1_GORGO (Q28433) Antigen peptide transporter 1 (APT1) (Peptide transporter| TAP1) (ATP-binding cassette sub-family B member 2) Length = 748 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = -2 Query: 283 LRLSSILCQDRPACHDDVALLESNPEVPEEDRHIRSPVGDSINPCSTHLITFQQLCISRG 104 L++ +L + V L+ + + E+ HI G +I TH QQL +G Sbjct: 679 LQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTH----QQLMEKKG 734 Query: 103 CFW 95 C+W Sbjct: 735 CYW 737
>ADT2_PONPY (Q5R5A1) ADP/ATP translocase 2 (Adenine nucleotide translocator 2)| (ANT 2) (ADP,ATP carrier protein 2) (Solute carrier family 25 member 5) Length = 297 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFKFYSGFPVYCVRIAPHVMMTWLF 223 Q+Q T Y G +DC ++ K G F+ G +R P + + F Sbjct: 36 QVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRHFPTQALNFAF 90
>MNCP_OXYFA (P15798) Macronuclear solute carrier homolog CR-MSC| Length = 371 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 7/52 (13%) Frame = -3 Query: 387 QIQKMQPDATGKYPYTGSLDCAMQTMKTGGPFK-------FYSGFPVYCVRI 253 ++ M+P G+ PY G +DC + +K K FY+G Y +R+ Sbjct: 244 RLHTMRPLPNGQMPYNGMIDCFNKIIKYECNSKWMSNFGSFYAGGEAYFLRL 295
>SYFA_CLOAB (Q97GK9) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 339 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 229 PRHHDMRGDPDTIYWKAGVELKWATSLHGLHGTV-QRPSVWVLSSG 363 P++H RG+ DT Y V L+ TS + + Q+P + ++S G Sbjct: 147 PKNHPARGEQDTFYINDNVVLRTQTSPVQVRTMLNQKPPIKMISPG 192
>POLG_CSFVB (P21530) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3898 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 17 LCDYCNNVKSTTANVSYGKNCLKLCLPKTT 106 L YCN V + + Y NC CLPK T Sbjct: 495 LSPYCN-VTTKIGYIWYTNNCTPACLPKNT 523
>TRMB_ZYMMO (Q5NR81) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 231 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 339 GSLDCAMQTMKTGGPFKFYSGFPVYC 262 G + + MK GG F+F + P+YC Sbjct: 152 GPIGLIARKMKKGGEFRFGTDHPIYC 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,686,858 Number of Sequences: 219361 Number of extensions: 1046219 Number of successful extensions: 2703 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 2584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2702 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)