| Clone Name | rbart50h01 |
|---|---|
| Clone Library Name | barley_pub |
>YEY8_YEAST (P40095) Hypothetical 63.7 kDa protein in BEM2-NCB1 intergenic| region Length = 573 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 6/43 (13%) Frame = +1 Query: 118 TTLLQHET------DEQLVPASSLPGDNNKIPIFTLPIASNRP 228 +T+ HET D +V + GDNN+IP+ P + NRP Sbjct: 330 STVNNHETAVPSIKDSGIVQELTALGDNNRIPVLPPPRSPNRP 372
>CEAM5_HUMAN (P06731) Carcinoembryonic antigen-related cell adhesion molecule 5| precursor (Carcinoembryonic antigen) (CEA) (Meconium antigen 100) (CD66e antigen) Length = 702 Score = 28.5 bits (62), Expect = 4.3 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +3 Query: 111 TYNYTPPA*N**AASSCQLTTR*QQQNSYLYTANCLKSTRR-HKNTCTYPRRGVDTCQR* 287 +Y Y P N + SC + Q S+L N + T+ + T G+ TCQ Sbjct: 423 SYTYYRPGVN--LSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN 480 Query: 288 NLALGHSFST 317 N A GHS +T Sbjct: 481 NSASGHSRTT 490
>CP74_LINUS (P48417) Cytochrome P450 74A, chloroplast precursor (EC 4.2.1.92)| (Allene oxide synthase) (Hydroperoxide dehydrase) Length = 536 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 8/45 (17%) Frame = -1 Query: 288 FIADRCRHLGEGMYMYSYVSWS--------I*GNWQCKDRNFVVV 178 F+ADR +GEG+ + YV WS N QC ++FVV+ Sbjct: 455 FVADR--FVGEGVKLMEYVMWSNGPETETPSVANKQCAGKDFVVM 497
>VG27_BPML5 (Q05234) Minor tail protein Gp27| Length = 336 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 139 TDEQLVPASSLPGDNNKIPIFTLPIASNRP 228 TD+ + P ++PG K+P F P N P Sbjct: 199 TDQYIFPKWTVPGSTEKVPNFPWPFPPNVP 228
>FUT4_BOVIN (Q8HZR3) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 398 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 280 SDKTLPLGTVFPRTHRVAHPPG 345 SD +P G ++PRTH PPG Sbjct: 192 SDIFVPYGYLYPRTHPSEQPPG 213
>GSPJ_KLEPN (P15749) General secretion pathway protein J precursor (Pullulanase| secretion protein pulJ) Length = 198 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 347 APGGWATRWVRGKTVPKGKVLSLTGVDTSARVCTCILMSPG 225 A G W W + +T+P+G ++LT ++ + L++PG Sbjct: 156 ASGRWQDEWQQAQTLPQGLEVTLT-LEPYGEIRRLFLLTPG 195
>EMSY_MOUSE (Q8BMB0) Protein EMSY| Length = 1264 Score = 27.3 bits (59), Expect = 9.5 Identities = 26/73 (35%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +1 Query: 145 EQLVPASSLPGDNNKIPIFTLPIASNRPGDIRIH---VHTLAEVSTPVSDK-TLPLGTVF 312 +Q+ P+ LP K TLP +SN P + + T V+TP + T TV Sbjct: 425 QQVQPSKILP----KPVTATLPTSSNSPIMVVSSNGAIMTTKLVTTPTGTQATYTRPTVS 480 Query: 313 PRTHRVAHPPGAA 351 P RVA PGAA Sbjct: 481 PSLGRVATTPGAA 493
>PTPRS_HUMAN (Q13332) Receptor-type tyrosine-protein phosphatase S precursor (EC| 3.1.3.48) (R-PTP-S) (Protein-tyrosine phosphatase sigma) (R-PTP-sigma) Length = 1948 Score = 27.3 bits (59), Expect = 9.5 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Frame = -2 Query: 326 RWVRGKT-------VPKGK-VLSLTGVDTSARVCTCILMSP-GRFEAIGSVKIGILLLSP 174 +W++G +P G+ VL LT V SA TC+ MS G EA+ + + L +P Sbjct: 277 KWMQGAEDLTPEDDMPVGRNVLELTDVKDSANY-TCVAMSSLGVIEAVAQITVKSLPKAP 335 Query: 173 GSEL 162 G+ + Sbjct: 336 GTPM 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,831,188 Number of Sequences: 219361 Number of extensions: 1232675 Number of successful extensions: 2896 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2896 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)