Clone Name | rbart50g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ULP2_YEAST (P40537) Ubiquitin-like-specific protease 2 (EC 3.4.2... | 32 | 0.58 | 2 | GBPR_AGRTU (P25547) HTH-type transcriptional regulator gbpR (Gal... | 28 | 8.4 |
---|
>ULP2_YEAST (P40537) Ubiquitin-like-specific protease 2 (EC 3.4.22.-)| Length = 1034 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 108 CIVSMC*ALFCHKEPTCMCFVTRNQHVWFDLYFQ 7 C+ S ++ HK P M FV+ + H F LYFQ Sbjct: 156 CVDSKTLRIYRHKAPCIMTFVSDHNHPKFSLYFQ 189
>GBPR_AGRTU (P25547) HTH-type transcriptional regulator gbpR (Galactose-binding| protein regulator) (GBP regulator) Length = 302 Score = 27.7 bits (60), Expect = 8.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 182 PRCFQIWCWRK 150 P CF IWCW K Sbjct: 289 PACFMIWCWMK 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,631,864 Number of Sequences: 219361 Number of extensions: 494036 Number of successful extensions: 1525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)