Clone Name | rbart50g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (E... | 28 | 5.4 | 2 | Y1618_HAEIN (P45275) Hypothetical ABC transporter ATP-binding pr... | 28 | 7.1 |
---|
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 38 SEYVEQNRKTRLEVFIRLLRS 100 +E +E+ RKT LE+FIRL R+ Sbjct: 817 AEKIEKRRKTELEIFIRLNRA 837
>Y1618_HAEIN (P45275) Hypothetical ABC transporter ATP-binding protein HI1618| Length = 217 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 125 RRNVFYQFLISTGE*RLLILSFDFAPHILNEVKRWNKVCPK 3 ++ +F Q I +G+ LL+ F P E+K + KVC K Sbjct: 39 QKRLFVQGEIGSGKTTLLLALLGFVPVTKGEIKLFGKVCRK 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,089,480 Number of Sequences: 219361 Number of extensions: 190215 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)