Clone Name | rbart50g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CSF3R_HUMAN (Q99062) Granulocyte colony-stimulating factor recep... | 31 | 0.88 | 2 | WA_EMENI (Q03149) Conidial yellow pigment biosynthesis polyketid... | 27 | 9.7 |
---|
>CSF3R_HUMAN (Q99062) Granulocyte colony-stimulating factor receptor precursor| (G-CSF-R) (CD114 antigen) Length = 836 Score = 30.8 bits (68), Expect = 0.88 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -3 Query: 200 GQGNDSPVSFLVLRSDGS---VYCGRFGILMMHRCKCGVVW 87 G N + ++ + L +GS + G FG+L++ C CG W Sbjct: 607 GATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAW 647
>WA_EMENI (Q03149) Conidial yellow pigment biosynthesis polyketide synthase (EC| 2.3.1.-) (PKS) Length = 2157 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 167 VLRSDGSVY-CGRFGILMMHRCKCGVVWSRSDRMTLVEVEQL 45 VL + ++Y CGR L+ RC+ G + + LVEV+QL Sbjct: 1013 VLSTSDTIYACGRRAQLLTERCQPGTHAMLAIKAPLVEVKQL 1054 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,685,110 Number of Sequences: 219361 Number of extensions: 812100 Number of successful extensions: 2552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2552 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)