Clone Name | rbart50f05 |
---|---|
Clone Library Name | barley_pub |
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 30.8 bits (68), Expect = 0.90 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 90 HPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS*HGLKLKANTTHA 245 HP P S P+ P+ H HP P+ + P Q S P HG +L +T+++ Sbjct: 213 HPHPHSHPHSHPHP---HPHPHPHQIPHPHPQPHSQP---HGHRLLRSTSNS 258
>TRUB_LEGPA (Q5X1C5) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 49 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 162 T NN+ L+ +QD+ L Q A + ++ +I+HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAIQHLT 242
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +3 Query: 78 KLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS 206 K +QHP P+ SP Q +HPSPN P ++ P S Sbjct: 126 KQQQHPSPNQQQPPSPNQQ---QHPSPNQQQHPSPNQQQHPNS 165
>COBL6_ARATH (O04500) COBRA-like protein 6 precursor| Length = 454 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 139 SVWVYGLQFGPESGPGCCLSLFAYYYGHFV 50 +V VY QF P CC+SL A+YY + V Sbjct: 217 AVCVYS-QFRSSPSPKCCVSLSAFYYQNIV 245
>TRUB_LEGPL (Q5WT38) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 49 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 162 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>TRUB_LEGPH (Q5ZRV6) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 49 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 162 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>ISPZ_HAEDU (Q7VKZ1) Probable intracellular septation protein| Length = 183 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 167 KPVR*RMLVFSLGIRASVWSRVR-SWMLFKFICLLLRAL 54 KPV +L L + VW+R+ W +F IC+L+ + Sbjct: 98 KPVVKMLLAKELSLPTQVWNRLNLGWAIFFIICMLINII 136
>ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel-1) (Telomere length regulation protein 1) (ATM homolog) Length = 2953 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +1 Query: 82 LNNIQDLTLDQTEARIPKLNTSIRHLTGFTDRTFKDDQSLHLDTDLNLK 228 ++N+ + LDQT+ KL+ +++ T +D+Q L ++T L L+ Sbjct: 1798 VHNVLEYELDQTQGMKQKLSEALKEWLTSTSPAARDNQKLLINTILYLR 1846
>FREM2_MOUSE (Q6NVD0) FRAS1-related extracellular matrix protein 2 precursor (ECM3| homolog) (NV domain-containing protein 1) Length = 3160 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Frame = +1 Query: 106 LDQTEARIPKLNTSIRHLTGFTDRTFK------DDQSLHLDTDLNLKQTRHTPTI*WRSG 267 L +TE + ++T + H++ + K + LH+ +L+ +H W SG Sbjct: 836 LRETELHVSDVDTDVTHISFTLTQAPKHGHMQISGRPLHVGGQFHLEDIKHGRISYWNSG 895 Query: 268 DES 276 DES Sbjct: 896 DES 898
>CRK_XENLA (P87378) SH2/SH3 adaptor crk (Adapter molecule crk) (CRK2)| Length = 296 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 75 NKLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQR 188 N+ HP P GP PY Q P PN + P R Sbjct: 197 NQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFAR 234
>IF2_CHLPN (Q9Z8M1) Translation initiation factor IF-2| Length = 890 Score = 27.7 bits (60), Expect = 7.6 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +1 Query: 7 KSLISRDNAQQ*TNTQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLTGFTDRTFK 186 K + S + T+ +NN++ N +++ A PK + ++LT F DR+ K Sbjct: 206 KPVASDKTGKPGTSEGGEQNNREKQFN-----PANRSPASGPKRDAGKKNLTDFRDRSKK 260 Query: 187 DDQSL 201 D+SL Sbjct: 261 SDESL 265
>CRK_CHICK (Q04929) Proto-oncogene C-crk (P38)| Length = 305 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 75 NKLKQHPGPDSGPN*SPYTQTEHKHPSPN 161 N+ HP P GP PY Q P PN Sbjct: 205 NQDSSHPQPLGGPEPGPYAQPSINTPLPN 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,444,216 Number of Sequences: 219361 Number of extensions: 946259 Number of successful extensions: 2149 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2148 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)