ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart50d02 |
|---|---|
| Clone Library Name | barley_pub |
>CYB_EULMM (O99797) Cytochrome b| Length = 379 Score = 30.8 bits (68), Expect = 0.91 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +TG WN ++L FT+ +T F GY Sbjct: 109 LTGTWNIGIILLFTVMATAFMGY 131
>MELK_HUMAN (Q14680) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (hMELK) (Protein kinase PK38) (hPK38) Length = 651 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 42 QDHGTKTCCSNLRYAAPDL-QGIHQLQKE 125 +D+ +TCC +L YAAP+L QG L E Sbjct: 161 KDYHLQTCCGSLAYAAPELIQGKSYLGSE 189
>MELK_MOUSE (Q61846) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (Protein kinase PK38) (mPK38) Length = 643 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 42 QDHGTKTCCSNLRYAAPDL-QGIHQLQKE 125 +D+ +TCC +L YAAP+L QG L E Sbjct: 161 KDYHLQTCCGSLAYAAPELIQGKSYLGSE 189
>CP51_ISSOR (Q02315) Cytochrome P450 51 (EC 1.14.13.70) (CYPLI) (P450-LIA1)| (Sterol 14-alpha demethylase) (Lanosterol 14-alpha demethylase) (P450-14DM) (Fragment) Length = 414 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 22 LYEQENYRTMEQKPAAPIYDTQHPIYRVFINSKKKLLRYYESKF 153 +Y+ N++ MEQK A + T+ R K ++L+Y+ + F Sbjct: 77 IYDCPNWKLMEQKKFAKVALTKESFIRYVPLIKDEMLKYFNANF 120
>CYB_ZALCA (Q36266) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EUMJU (Q34471) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EULMF (O99798) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNMGIILLFTVMATAFMGY 131
>CYB_ARCGZ (Q33688) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_HYSAF (Q04910) Cytochrome b| Length = 384 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S T WN +LL FT+ +T F GY Sbjct: 106 SYMFTETWNIGILLLFTVMATAFMGY 131
>TRI4_FUSSP (Q12612) Trichodiene oxygenase (EC 1.14.-.-) (Cytochrome P450 58)| Length = 520 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -2 Query: 263 RWVAVARLGVPLTSIIVWFSES*DISFGYRTSFLIMLNLLS*YRSSFFLELMNT 102 RW+ A +PL I FS+ GY +F M +S ++ +EL +T Sbjct: 430 RWIEAAEKKIPLKKYITNFSQGSRQCIGYTMAFAEMYLAMSRIARAYDVELYDT 483
>CYB_PROSA (Q6ELU8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 41 TGPWNKNLLLQFTIRSTRFTGY 106 T WN +LL FT+ +T F GY Sbjct: 110 TETWNIGILLLFTVMATAFMGY 131
>CYB_OMMRO (Q678S8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MIRLE (Q35019) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MICMU (Q9G0S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_LOBCR (Q678S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_HALGR (P38593) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_GALEE (Q85PP0) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 29 SRKITGPWNKNLLLQFTIRSTRFTGY 106 S + WN +LL FT+ +T F GY Sbjct: 106 SHTFSETWNVGILLLFTVMATAFMGY 131
>CYB_EULRU (O99800) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULMO (O99799) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULFC (Q34459) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULCO (Q5VJ65) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 38 ITGPWNKNLLLQFTIRSTRFTGY 106 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,186,957 Number of Sequences: 219361 Number of extensions: 849697 Number of successful extensions: 3236 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 3192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3236 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
