ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart50c05 |
|---|---|
| Clone Library Name | barley_pub |
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 50.1 bits (118), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAAIYHVVVIRAIPFKSR Sbjct: 264 PFIGAALAAIYHVVVIRAIPFKSR 287
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 49.3 bits (116), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YHVVVIRAIPFKSR Sbjct: 262 PFIGAALAALYHVVVIRAIPFKSR 285
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 49.3 bits (116), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YHVVVIRAIPFKSR Sbjct: 262 PFIGAALAALYHVVVIRAIPFKSR 285
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YHV+VIRAIPFKSR Sbjct: 262 PFIGAALAALYHVIVIRAIPFKSR 285
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 47.8 bits (112), Expect = 7e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAAIYH VVIRAIPFKSR Sbjct: 258 PFIGAALAAIYHQVVIRAIPFKSR 281
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PF+GAALAAIYH V+IRAIPFKSR Sbjct: 265 PFVGAALAAIYHQVIIRAIPFKSR 288
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 45.8 bits (107), Expect = 2e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YH +VIRAIPFKSR Sbjct: 262 PFIGAALAALYHQLVIRAIPFKSR 285
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 45.8 bits (107), Expect = 2e-05 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YH VVIRAIPFKS+ Sbjct: 266 PFIGAALAALYHQVVIRAIPFKSK 289
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 45.4 bits (106), Expect = 3e-05 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YH +VIRAIPFKS+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKSK 286
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 45.4 bits (106), Expect = 3e-05 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSR 315 PFIGAALAA+YH +VIRAIPFKS+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKSK 286
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPF 324 P IGAALAAIYH ++IRA+PF Sbjct: 263 PMIGAALAAIYHQIIIRAMPF 283
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 128 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 289 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PFIGAA+AA YH V+RA KS G Sbjct: 253 PFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PFIGAA+AA YH V+RA KS G Sbjct: 255 PFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRA 333 PFIGAA+AA+YH V++RA Sbjct: 257 PFIGAAIAALYHQVILRA 274
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRA 333 PFIGAA+AA+YH +V+RA Sbjct: 254 PFIGAAIAALYHQIVLRA 271
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 32.3 bits (72), Expect = 0.28 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PF+GAA+AA YH V+RA K+ G Sbjct: 254 PFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 32.0 bits (71), Expect = 0.37 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PFIGA +AA YH V+RA KS G Sbjct: 253 PFIGATIAAFYHQFVLRASGSKSLG 277
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 32.0 bits (71), Expect = 0.37 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PF+GAA+AA YH ++RA K+ G Sbjct: 260 PFVGAAIAAFYHQYILRAGAIKALG 284
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 31.6 bits (70), Expect = 0.48 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG*WTNQ 297 PF GAA+AA YH V+RA K+ G + +Q Sbjct: 254 PFAGAAIAAFYHQFVLRAGAIKALGSFRSQ 283
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.48 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 209 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 304 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PFIGA AA YH ++RA K+ G Sbjct: 250 PFIGALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PF+GA AA YH V+RA K+ G Sbjct: 250 PFVGALAAAAYHQYVLRAAAIKALG 274
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 P IGAA AA YH ++RA K+ G Sbjct: 255 PMIGAAAAAFYHQFILRAAAIKALG 279
>RS5_HALSA (Q9HPB4) 30S ribosomal protein S5P| Length = 212 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 360 DLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLFIVDRSCGGG 235 D+ D G PL+EP +VDQ + D +L + +V R G Sbjct: 24 DMSEALDTGLPLKEPEIVDQLLPGLDDEVLDINMVQRMTDSG 65
>YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromosome III| Length = 610 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 7 NNLHTYARWIKWRAWYWYNAKG 72 NN Y RW++W +W Y +G Sbjct: 526 NNFPVYIRWMQWTSWCRYGFEG 547
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKSRG 312 PF+GA AA YH ++RA K+ G Sbjct: 248 PFLGALAAAAYHQYILRASAIKALG 272
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 137 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 244 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 137 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 244 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 140 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQT 298 QAH P++DGR +V+GR AH PP DRS +DK +A ++ Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVRS 113
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRAIPFKS 318 PF+GA AA YH ++RA K+ Sbjct: 246 PFVGALAAAAYHQYILRAAAIKA 268
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 128 RRCRQAHTPRRDGRFENYYSVRGRDTI 208 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRA 333 P IGAA+AA YH V+RA Sbjct: 259 PLIGAAIAAAYHQYVLRA 276
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 386 PFIGAALAAIYHVVVIRA 333 P IGAA+AA YH V+RA Sbjct: 260 PLIGAAIAAAYHQYVLRA 277
>NPHP4_MOUSE (P59240) Nephrocystin-4 (Nephroretinin)| Length = 1425 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 363 GDLPRGGDQGDPLQEPRLVDQSVWAAMDGILSLF 262 G LP GD GD L++PR + W D +L+ Sbjct: 219 GLLPPHGDTGDALRKPRFQKPTTWHLDDLFFTLY 252
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +2 Query: 206 IHVRAHQQPP---PPPHDRSTMN 265 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 24.6 bits (52), Expect(2) = 6.6 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +3 Query: 126 GDAAGRHTHRGETADLRTITACAAETRSTYARTSNHHHHH 245 G + H+ R + T+S + +HHHHH Sbjct: 644 GSSGSGHSIRATSHPRAPTQPSTTTTKSNGSSNHHHHHHH 683 Score = 21.6 bits (44), Expect(2) = 6.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 221 HQQPPPPPHDRSTMNS 268 H PPPPP +++ S Sbjct: 697 HAPPPPPPPTQASSTS 712
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 123 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 28 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 221 HQQPPPPPHDRSTM 262 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 123 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 28 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868
>GLB1_MAIZE (P15590) Globulin-1 S allele precursor (GLB1-S) (7S-like)| Length = 573 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 171 LRTITACAAETRSTYARTSNHHHH--HMIGRR*TAIRFHPWPPR 296 L + CAA ++ NHHHH H GR PW R Sbjct: 9 LLAVLLCAAAAVASSWEDDNHHHHGGHKSGRCVRRCEDRPWHQR 52
>I17RA_HUMAN (Q96F46) Interleukin-17 receptor A precursor (IL-17 receptor)| Length = 866 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 360 DLPRGGDQGDPLQEPRLVDQSVWAAMDGI-LSLFIVDRSCGGGGGC 226 D P G P+ P L+ + V ++G+ LSLF SC GGC Sbjct: 725 DSPLGSST--PMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGC 768
>ZO3_CANFA (O62683) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 898 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 161 DGRFENYYSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 271 D F + S G + PPPPPH + +++SD Sbjct: 281 DSSFLDDISALGSELSQAVPSHVPPPPPHAQRSLDSD 317
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -3 Query: 336 GDPLQEPRLVDQSVWAAMDGIL---SLFIVD 253 G P Q+ R+ Q VWAA++ L L+I+D Sbjct: 5 GPPQQQVRMAQQQVWAALEVALRVPCLYIID 35
>NRIP1_MOUSE (Q8CBD1) Nuclear receptor-interacting protein 1 (Nuclear factor| RIP140) (Receptor-interacting protein 140) Length = 1161 Score = 27.3 bits (59), Expect = 9.1 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 206 SCLGRARCNSSQI-CRLSSVCVPAGSVACSSLRVSVSIVPAVLLSLPFALYQYHARHLIQ 30 SC R + +S + R S P SVACS L A+LLS L QY H ++ Sbjct: 236 SCAARLQAVASMVEKRASPAASPKPSVACSQL--------ALLLSSEAHLQQYSREHALK 287
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 210 TYARTSNHHHHHMIGRR*TAIRFHPWP 290 +YA HHH H+ G R +H +P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYP 161
>MEOX2_HUMAN (P50222) Homeobox protein MOX-2 (Mesenchyme homeobox 2) (Growth| arrest-specific homeobox) Length = 304 Score = 23.5 bits (49), Expect(2) = 9.2 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 228 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 320 +HHHHH ++ A++ + P++ P +AA Sbjct: 74 HHHHHHHQQQQHQALQTNWHLPQMSSPPSAA 104 Score = 22.3 bits (46), Expect(2) = 9.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 207 STYARTSNHHHHH 245 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74
>MEOX2_RAT (P39020) Homeobox protein MOX-2 (Growth arrest-specific homeobox)| Length = 303 Score = 23.5 bits (49), Expect(2) = 9.2 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 228 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 320 +HHHHH ++ A++ + P++ P +AA Sbjct: 73 HHHHHHHQQQQHQALQSNWHLPQMSSPPSAA 103 Score = 22.3 bits (46), Expect(2) = 9.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 207 STYARTSNHHHHH 245 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74
>MEOX2_MOUSE (P32443) Homeobox protein MOX-2 (Mesenchyme homeobox 2)| Length = 303 Score = 23.5 bits (49), Expect(2) = 9.2 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 228 NHHHHHMIGRR*TAIRFHPWPPRLIGPLAAA 320 +HHHHH ++ A++ + P++ P +AA Sbjct: 73 HHHHHHHQQQQHQALQSNWHLPQMSSPPSAA 103 Score = 22.3 bits (46), Expect(2) = 9.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 207 STYARTSNHHHHH 245 S + R +HHHHH Sbjct: 62 SQHHRGHHHHHHH 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,241,826 Number of Sequences: 219361 Number of extensions: 1128838 Number of successful extensions: 5629 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 4376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5153 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
