Clone Name | rbart50c02 |
---|---|
Clone Library Name | barley_pub |
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 347 GAHGERL-PGAFGSAQEGQGLRPLPC 273 G H ER PG+FG+A +G RP C Sbjct: 729 GEHCERCRPGSFGNATGSRGCRPCQC 754
>EX1_BUCBP (Q89A43) Exodeoxyribonuclease I (EC 3.1.11.1) (Exonuclease I) (DNA| deoxyribophosphodiesterase) (dRPase) Length = 481 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 257 PICQSILIVGWVRQYSLLCFVTEFEFQ*TNYTFVVHLKDCII 132 P +S+LI G +Y+ L V EFEF Y+ + CII Sbjct: 59 PDPESVLITGISPKYTSLFGVNEFEFAKKIYSLFMKSDTCII 100
>ADM2_RAT (P61312) ADM2 precursor (Intermedin) [Contains: Adrenomedullin-2| (Intermedin-long) (IMDL); Intermedin-short (IMDS)] Length = 146 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 226 HPTMS-MLWQIGDVRQTQGSGLRPWPSWALPNAPGSRSP*APSRHV 360 HP++ ++W+ Q QG G + LP GSR P P RHV Sbjct: 50 HPSLRPVVWKPPHALQPQGRGNPALATVHLPQGGGSRHP-GPQRHV 94
>GPR37_HUMAN (O15354) Probable G-protein coupled receptor 37 precursor| (Endothelin B receptor-like protein 1) (ETBR-LP-1) (Parkin-associated endothelin receptor-like receptor) (PAELR) Length = 613 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 265 RQTQGSGLRPWPSWALPNAPG 327 R+ QG+ PSW LP APG Sbjct: 73 REEQGAAFLAGPSWDLPAAPG 93
>RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination protein O)| Length = 234 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 315 WQCPRRPRPKATSLRLAYITNLPEHTHSWVGSSIFV 208 WQ +P P+ SL L ++ +PE H + SS+F+ Sbjct: 103 WQ--EKPSPQLFSLFLNFLQRIPETPHPYFFSSMFL 136
>YKW2_YEAST (P35995) Putative 82.2 kDa transcriptional regulatory protein in| FRE2 5'region Length = 705 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -2 Query: 285 ATSLRLAYITNLPEHTHSWVGSSIFVAVFRYGI*VPINQLHLCRSLERLYY 133 AT + ++NL TH +F + + P+N LHLC ++ Y+ Sbjct: 463 ATLHMIGSLSNLYTLTHQ----DFDARIFNFSVLAPLNSLHLCFNVLETYF 509
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 345 CSWRTTSGSVWQCPRRPRPKATSLR-LAYITNLPEHTHSWVGSSIFV 208 CS T SG +WQC P P S++ A+I+ E + G +V Sbjct: 405 CSSCTCSGGLWQCQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYV 451
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 123 YIQGLAVCITPAFCGTCGPNV 61 +I GL +C+ PA CGPN+ Sbjct: 12 WILGLLLCLGPAAAKVCGPNM 32 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,715,935 Number of Sequences: 219361 Number of extensions: 1130558 Number of successful extensions: 2443 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2442 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)