ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart50b04 |
|---|---|
| Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 36.6 bits (83), Expect = 0.015 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 196 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 357 ++ + H PR + +N Y+ DTI H+ PPPPP T +SD+ S + Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 205 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 312 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 205 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 312 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +1 Query: 274 IHVRAHQQPP---PPPHDRSTMN 333 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 196 RRCRQAHTPRRDGRFENYYSVRGRDTI 276 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>RL4_HALMA (P12735) 50S ribosomal protein L4P (Hmal4) (Hl6)| Length = 246 Score = 28.1 bits (61), Expect = 5.5 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 208 QAHTPRRDGRFENY-YSVRGRDTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQ 363 QAH P++DGR +V+GR AH PP DRS +DK +A + Sbjct: 67 QAHVPKQDGRARRVPQAVKGRS-----AH--PPKTEKDRSLDLNDKERQLAVR 112
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 24.6 bits (52), Expect(2) = 6.8 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +2 Query: 194 GDAAGRHTHRGETADLRTITACAAETRSTYARTSNHHHHH 313 G + H+ R + T+S + +HHHHH Sbjct: 644 GSSGSGHSIRATSHPRAPTQPSTTTTKSNGSSNHHHHHHH 683 Score = 21.6 bits (44), Expect(2) = 6.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 289 HQQPPPPPHDRSTMNS 336 H PPPPP +++ S Sbjct: 697 HAPPPPPPPTQASSTS 712
>GLB1_MAIZE (P15590) Globulin-1 S allele precursor (GLB1-S) (7S-like)| Length = 573 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 239 LRTITACAAETRSTYARTSNHHHH--HMIGRR*TAIRFHPWPPR 364 L + CAA ++ NHHHH H GR PW R Sbjct: 9 LLAVLLCAAAAVASSWEDDNHHHHGGHKSGRCVRRCEDRPWHQR 52
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 191 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 96 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 191 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 96 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 289 HQQPPPPPHDRSTM 330 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 278 TYARTSNHHHHHMIGRR*TAIRFHPWP 358 +YA HHH H+ G R +H +P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYP 161
>ZO3_CANFA (O62683) Tight junction protein ZO-3 (Zonula occludens 3 protein)| (Zona occludens 3 protein) (Tight junction protein 3) Length = 898 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 229 DGRFENYYSVRGRDTIHVRAHQQPPPPPHDRSTMNSD 339 D F + S G + PPPPPH + +++SD Sbjct: 281 DSSFLDDISALGSELSQAVPSHVPPPPPHAQRSLDSD 317
>NRIP1_MOUSE (Q8CBD1) Nuclear receptor-interacting protein 1 (Nuclear factor| RIP140) (Receptor-interacting protein 140) Length = 1161 Score = 27.3 bits (59), Expect = 9.3 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 274 SCLGRARCNSSQI-CRLSSVCVPAGSVACSSLRVSVSIVPAVLLSLPFALYQYHARHLIQ 98 SC R + +S + R S P SVACS L A+LLS L QY H ++ Sbjct: 236 SCAARLQAVASMVEKRASPAASPKPSVACSQL--------ALLLSSEAHLQQYSREHALK 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,514,523 Number of Sequences: 219361 Number of extensions: 1052661 Number of successful extensions: 4850 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4380 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
