| Clone Name | rbart50a04 |
|---|---|
| Clone Library Name | barley_pub |
>RDRP_LYCVA (P14240) RNA-directed RNA polymerase (EC 2.7.7.48)| Length = 2210 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 124 NYAPEREPALLSI-GIPLLLQCLQAPDCTMH*CTPKHD 14 N+ +REP ++ I G+ LL +C++ CT HD Sbjct: 28 NFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCTHNHD 65
>LUXD1_PHOLE (P21309) Acyl transferase (EC 2.3.1.-) (ACT)| (Myristoyl-ACP-specific thioesterase) (C14ACP-TE) Length = 315 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +1 Query: 169 HNNSYLSEGMIKRTMMSGKSILPIYSTAASFVVLRIAMSNHGGLAVGDGKQFLASSESET 348 +N ++ G +R M + L Y F V+R NH GL+ G+ KQF S + Sbjct: 37 NNTIVIASGFARR--MDHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFSMSVGKHS 94 Query: 349 LLCFI 363 LL I Sbjct: 95 LLTVI 99
>GUAA_GLOVI (Q7NHC2) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 551 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 121 YAPEREPALLSIGIPLLLQC 62 YAP+ +PAL +GIP+L C Sbjct: 95 YAPQCDPALWELGIPILGVC 114
>5NT1B_HUMAN (Q96P26) Cytosolic 5'-nucleotidase 1B (EC 3.1.3.5) (Cytosolic| 5'-nucleotidase IB) (cN1B) (cN-IB) (Autoimmune infertility-related protein) Length = 610 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 352 GESHSLKRPGIACRRRQQGHRGCSLRFGEQQNSLRLNKSGGLIYRSSW 209 G H+++ C +QG + +R G Q++SLR S G + RS W Sbjct: 75 GPCHTIRIYIHMCLLWEQGQQITMMR-GSQESSLRKTDSRGYLVRSQW 121
>REG3B_RAT (P25031) Regenerating islet-derived protein 3 beta precursor (Reg| III-beta) (Pancreatitis-associated protein 1) (Peptide 23) (REG-2) Length = 175 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -2 Query: 322 IACRRRQQGHRGCSLRFGEQQNSLRLNKSGGLIYRSSWCA*SSPLIG 182 +AC++R +GH L E + K+ G Y+ +W P +G Sbjct: 66 LACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLG 112
>ENV_VILV1 (P23422) Env polyprotein (Coat polyprotein) [Contains: Leader| peptide; Exterior membrane glycoprotein; Transmembrane glycoprotein] Length = 989 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 261 CCSPNRNEQPRWPCCRRRQ 317 C P+RNE +W C RR+ Sbjct: 562 CSLPHRNESNKWTCAARRK 580
>PRR1_ORYSA (Q689G9) Two-component response regulator-like PRR1| (Pseudo-response regulator 1) (OsPRR1) Length = 518 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 292 GGLAVGDGKQFLASSESETLLC 357 GG AVG G+QF+ S+ LLC Sbjct: 12 GGAAVGGGQQFVDRSKVRILLC 33
>J1L_HCMVA (P17143) Hypothetical protein J1L| Length = 309 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = -1 Query: 149 ESSCKDMKQLRTRKRTCSSFYWNSIATSMSTSTRLHHALMHTKT*FC 9 E+ C+ R C+ ++ T+++T +R HHA H + C Sbjct: 87 EARCRQQIPWDDTHRQCAGSVGHNTLTALNTPSRTHHAAPHRRCFGC 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,032,413 Number of Sequences: 219361 Number of extensions: 1114259 Number of successful extensions: 2445 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)