ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart50a03 |
|---|---|
| Clone Library Name | barley_pub |
>PAX2A_BRARE (Q90268) Paired box protein Pax-2a (Pax[Zf-b]) (No isthmus protein)| Length = 410 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 32 NGRPLPDVVRQRIVELAHQGVRPC 55
>PAX2_MOUSE (P32114) Paired box protein Pax-2| Length = 415 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 28 NGRPLPDVVRQRIVELAHQGVRPC 51
>PAX5_MOUSE (Q02650) Paired box protein Pax-5 (B-cell-specific transcription| factor) (BSAP) Length = 391 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 29 NGRPLPDVVRQRIVELAHQGVRPC 52
>PAX5_HUMAN (Q02548) Paired box protein Pax-5 (B-cell-specific transcription| factor) (BSAP) Length = 391 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 29 NGRPLPDVVRQRIVELAHQGVRPC 52
>PAX2_HUMAN (Q02962) Paired box protein Pax-2| Length = 416 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 29 NGRPLPDVVRQRIVELAHQGVRPC 52
>GIDA_SHEON (Q8E8A9) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 629 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -3 Query: 288 AACQVQSSNAWCITKDKESAHV*MHEPDTMSGRKSAETMYTARIPFR 148 A+ QVQ AWC +D+ V + + T+ G K M+T+R +R Sbjct: 391 ASLQVQGKEAWCPRRDEAYIGVLVDDLSTL-GTKEPYRMFTSRAEYR 436
>PAX8_CANFA (P47240) Paired box protein Pax-8| Length = 459 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 22 NGRPLPEVVRQRIVDLAHQGVRPC 45
>PAX8_MOUSE (Q00288) Paired box protein Pax-8| Length = 457 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 22 NGRPLPEVVRQRIVDLAHQGVRPC 45
>PAX8_HUMAN (Q06710) Paired box protein Pax-8| Length = 450 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 22 NGRPLPEVVRQRIVDLAHQGVRPC 45
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 295 HGGRLPGAVQQRVVHYQGQGVRPC 224 +G LP V+QR+V QGVRPC Sbjct: 22 NGRPLPEVVRQRIVDLAHQGVRPC 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,942,200 Number of Sequences: 219361 Number of extensions: 902391 Number of successful extensions: 2120 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2119 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
