Clone Name | rbart49g09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PRTP_HCMVA (P16724) Probable processing and transport protein UL... | 31 | 0.80 |
---|
>PRTP_HCMVA (P16724) Probable processing and transport protein UL56 (HFLF0| protein) Length = 850 Score = 31.2 bits (69), Expect = 0.80 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 53 TYSRKWKILNANLRHLYRQHSILLVLLSELGRPGHRARVPLA 178 TY+++W +L + LY+ + L+L L RP VP A Sbjct: 735 TYNKEWPLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTA 776 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,000,347 Number of Sequences: 219361 Number of extensions: 487418 Number of successful extensions: 1167 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1166 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)