| Clone Name | rbart49g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CXA9_RAJOC (P69999) Gap junction alpha-9 protein (Connexin-35) (... | 33 | 0.47 | 2 | CXA9_RAJER (P69998) Gap junction alpha-9 protein (Connexin-35) (... | 33 | 0.47 | 3 | CUL3_SCHPO (Q09760) Cullin-3 (Cul-3) | 32 | 1.4 |
|---|
>CXA9_RAJOC (P69999) Gap junction alpha-9 protein (Connexin-35) (Cx35)| Length = 302 Score = 33.1 bits (74), Expect = 0.47 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 5/94 (5%) Frame = +2 Query: 32 QSDRLSKT*RLQNITDITLTRIHLVFNKKKEQNWCIGAYTILGI-LPLMYDAVRMICLKA 208 ++ ++SK R + I+ + I +VF E + +G Y + G +P MY+ R C+K Sbjct: 162 RNSKMSKIRRQEGISRFYI--IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKM 219 Query: 209 VASYQPRKHKET----HTFFADAFCLVFSTND*N 298 V Y R ++T F C++ + + N Sbjct: 220 VECYVSRPTEKTVFLVFMFAVSGLCVILNLAELN 253
>CXA9_RAJER (P69998) Gap junction alpha-9 protein (Connexin-35) (Cx35)| Length = 302 Score = 33.1 bits (74), Expect = 0.47 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 5/94 (5%) Frame = +2 Query: 32 QSDRLSKT*RLQNITDITLTRIHLVFNKKKEQNWCIGAYTILGI-LPLMYDAVRMICLKA 208 ++ ++SK R + I+ + I +VF E + +G Y + G +P MY+ R C+K Sbjct: 162 RNSKMSKIRRQEGISRFYI--IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKM 219 Query: 209 VASYQPRKHKET----HTFFADAFCLVFSTND*N 298 V Y R ++T F C++ + + N Sbjct: 220 VECYVSRPTEKTVFLVFMFAVSGLCVILNLAELN 253
>CUL3_SCHPO (Q09760) Cullin-3 (Cul-3)| Length = 785 Score = 31.6 bits (70), Expect = 1.4 Identities = 19/65 (29%), Positives = 35/65 (53%) Frame = -3 Query: 306 MYLFQSLVEKTRQNASAKNVWVSLCLRGW*LATAFKQIILTASYMSGKIPKIVYAPMHQF 127 M L Q L+++ + N++ ++ +L L LA+ F I L+ + PK++ A + QF Sbjct: 514 MNLSQELLQEYKHNSALQSAKPALDLNVSILASTFWPIDLSPHKIKCNFPKVLLAQIDQF 573 Query: 126 CSFFL 112 F+L Sbjct: 574 TDFYL 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,174,472 Number of Sequences: 219361 Number of extensions: 1716765 Number of successful extensions: 3635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3635 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)