| Clone Name | rbart49f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UROL1_HUMAN (Q5DID0) Uromodulin-like 1 precursor (Olfactorin) | 27 | 9.4 | 2 | RLA0_METAC (Q8TI80) Acidic ribosomal protein P0 homolog (L10E) | 27 | 9.4 | 3 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 27 | 9.4 | 4 | TAOK2_RAT (Q9JLS3) Serine/threonine-protein kinase TAO2 (EC 2.7.... | 27 | 9.4 |
|---|
>UROL1_HUMAN (Q5DID0) Uromodulin-like 1 precursor (Olfactorin)| Length = 1318 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 202 SFP*KASPGRPHTQPA--ERAVPRPTEHTGTSCTLGVDRSEATHGV 333 +F SPG P PA + P P+ G S +G DR+ GV Sbjct: 585 NFTLSPSPGYPQGTPAAGQAWTPEPSPRRGGSNVVGYDRNNTGKGV 630
>RLA0_METAC (Q8TI80) Acidic ribosomal protein P0 homolog (L10E)| Length = 347 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/47 (21%), Positives = 26/47 (55%) Frame = +2 Query: 212 EKHRQADHIPNQQKEQCRAPQSILVHLVLWGLIGLRQLMAFHPTKLR 352 E+ +HIP +K++ + ++ ++G++G+ ++A K+R Sbjct: 3 EERHHTEHIPQWKKDEIENIKELIQSHKVFGMVGIEGILATKMQKIR 49
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 106 EIHQLSGEPFLLCVYRYQHHRLVPRRAESLL 14 E+ G PFLL +++ +H R V +R +SLL Sbjct: 998 EVFGTFGIPFLLRIHQGEHFREVMKRIQSLL 1028
>TAOK2_RAT (Q9JLS3) Serine/threonine-protein kinase TAO2 (EC 2.7.11.1)| (Thousand and one amino acid protein 2) Length = 1235 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 156 GTQFRYRHQWQPSLPFFPLKSIARPTTYPTSRKSSAAPHRAY 281 G+ Y +QP + PL+ A P PTS SS+A RAY Sbjct: 423 GSDNLYDDPYQPEMTPGPLQPPAAP---PTSTSSSSARRRAY 461 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,905,695 Number of Sequences: 219361 Number of extensions: 1220987 Number of successful extensions: 3145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3145 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)