Clone Name | rbart49d01 |
---|---|
Clone Library Name | barley_pub |
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 36.6 bits (83), Expect = 0.028 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 CF C E GH SRECPN+A Sbjct: 45 CFRCGEEGHMSRECPNEA 62 Score = 35.4 bits (80), Expect = 0.062 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 CF C E+GH SR+CPN A Sbjct: 72 CFRCGEAGHMSRDCPNSA 89 Score = 33.5 bits (75), Expect = 0.24 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C+ C ESGH SRECP+ Sbjct: 198 CYKCGESGHMSRECPS 213 Score = 32.0 bits (71), Expect = 0.68 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C+ C ++GH SR+CPN Sbjct: 170 CYKCGDAGHISRDCPN 185 Score = 32.0 bits (71), Expect = 0.68 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C+ C ++GH SR+CPN Sbjct: 142 CYKCGDAGHISRDCPN 157 Score = 31.2 bits (69), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C+ C E+GH SR+CP+ Sbjct: 255 CYKCGEAGHISRDCPS 270 Score = 29.6 bits (65), Expect = 3.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH SRECP Sbjct: 224 CYKCGKPGHISRECP 238 Score = 29.6 bits (65), Expect = 3.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C+ C + GH SR+CP+ Sbjct: 99 CYKCGQEGHLSRDCPS 114 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C +C + GH++RECP Sbjct: 18 CRNCGKEGHYARECP 32
>GAG_MPMV (P07567) Gag polyprotein (Core polyprotein) [Contains: Core protein| p10; Core phosphoprotein pp24; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 656 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQP-VRSECP 244 CF C + GHF++ C AH A+P V CP Sbjct: 548 CFKCGKKGHFAKNCHEHAHNNAEPKVPGLCP 578
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 33.5 bits (75), Expect = 0.24 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 CF+C E GH S ECPN A Sbjct: 475 CFNCGEQGHRSNECPNPA 492 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C++C + GH SR+CP + Sbjct: 398 CYNCQQPGHNSRDCPEE 414 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C++C + GH SR+CP + Sbjct: 284 CYNCQQPGHNSRDCPEE 300
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 33.5 bits (75), Expect = 0.24 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 CF+C E GH S ECPN A Sbjct: 264 CFNCGEQGHRSNECPNPA 281
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 32.7 bits (73), Expect = 0.40 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C++C++ GHF R+CPN Sbjct: 232 CYNCNQPGHFKRDCPN 247
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 32.7 bits (73), Expect = 0.40 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF+C+++GH SRECP Sbjct: 67 CFNCNQTGHISRECP 81 Score = 30.4 bits (67), Expect = 2.0 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C++C+E+GH S++CP Sbjct: 137 CYNCNETGHISKDCP 151 Score = 29.3 bits (64), Expect = 4.4 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 C++C ++GH SR+C N Sbjct: 118 CYTCGQAGHMSRDCQN 133
>GAG_GALV (P21416) Gag polyprotein [Contains: Core protein p15; Core protein| p12; Core protein p30; Core protein p10] Length = 519 Score = 32.7 bits (73), Expect = 0.40 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH 277 C C E GH++RECP K H Sbjct: 490 CAYCKEKGHWARECPRKKH 508
>GAG_BLVJ (P03344) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 32.0 bits (71), Expect = 0.68 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 C+ C + GH++R+CP K A P CP+ Sbjct: 346 CYRCLKEGHWARDCPTK---ATGPPPGPCPI 373
>GRP2B_ARATH (Q38896) Glycine-rich protein 2b (AtGRP2b)| Length = 201 Score = 32.0 bits (71), Expect = 0.68 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 C+SC ESGHF+R+C Sbjct: 182 CYSCGESGHFARDC 195 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 CF C E GH +REC Sbjct: 138 CFKCGEPGHMAREC 151
>ZCHC5_HUMAN (Q8N8U3) Zinc finger CCHC domain-containing protein 5| Length = 475 Score = 31.6 bits (70), Expect = 0.89 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQ 265 C C GHF+R+CP K H A Q Sbjct: 445 CLYCGYPGHFARDCPVKPHQALQ 467
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 31.6 bits (70), Expect = 0.89 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF C SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 C+ C ESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 31.6 bits (70), Expect = 0.89 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF C SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 C+ C ESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 31.6 bits (70), Expect = 0.89 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF C SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 C+ C ESGH +REC +A Sbjct: 158 CYRCGESGHLARECTIEA 175
>COAT_FMVD (P09519) Probable coat protein| Length = 489 Score = 31.6 bits (70), Expect = 0.89 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+E GH++ ECPN+ Sbjct: 411 CWICTEEGHYANECPNR 427
>GRP2_NICSY (P27484) Glycine-rich protein 2| Length = 214 Score = 31.6 bits (70), Expect = 0.89 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 CF C ESGHF+R+C Sbjct: 159 CFKCGESGHFARDC 172 Score = 30.0 bits (66), Expect = 2.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 C+ C E GHF+REC Sbjct: 196 CYKCGEDGHFAREC 209
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 31.6 bits (70), Expect = 0.89 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF C SGH++RECP Sbjct: 6 CFKCGRSGHWARECP 20 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 C+ C ESGH +REC +A Sbjct: 159 CYRCGESGHLARECTIEA 176
>COAT_SOCMV (P15627) Coat protein| Length = 441 Score = 31.6 bits (70), Expect = 0.89 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVR 256 C+ C E GH++ ECP K + AQ ++ Sbjct: 383 CWLCHEEGHYANECPKKDNKKAQTLK 408
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 30.4 bits (67), Expect = 2.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 CF C +GH++RECP Sbjct: 6 CFKCGRTGHWARECP 20 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKA 280 C+ C ESGH +REC +A Sbjct: 153 CYRCGESGHLARECTIEA 170
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 C+ C + GH++R+CP K P CP+ Sbjct: 346 CYRCLKEGHWARDCPTK---TTGPPPGPCPI 373
>ZCHC9_MOUSE (Q8R1J3) Zinc finger CCHC domain-containing protein 9| Length = 273 Score = 30.0 bits (66), Expect = 2.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 CF C E GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201
>LARK_DROME (Q94901) RNA-binding protein lark| Length = 352 Score = 30.0 bits (66), Expect = 2.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C SGH+S+ECP Sbjct: 170 CYRCGRSGHWSKECP 184
>ZCHC9_HUMAN (Q8N567) Zinc finger CCHC domain-containing protein 9| Length = 271 Score = 30.0 bits (66), Expect = 2.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 333 CFSCSESGHFSRECPN 286 CF C E GH SR CP+ Sbjct: 186 CFVCGEMGHLSRSCPD 201
>GAG_HTL1M (P14077) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 428 Score = 29.6 bits (65), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 CF C ++GH+SR+C +P CPL Sbjct: 356 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 381
>GAG_HTL1C (P14076) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 29.6 bits (65), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 CF C ++GH+SR+C +P CPL Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>GAG_HTL1A (P03345) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 29.6 bits (65), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 CF C ++GH+SR+C +P CPL Sbjct: 357 CFRCGKAGHWSRDCTQ-----PRPPPGPCPL 382
>ZCH11_HUMAN (Q5TAX3) Zinc finger CCHC domain-containing protein 11| Length = 1644 Score = 29.3 bits (64), Expect = 4.4 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 8/35 (22%) Frame = -3 Query: 333 CFSCSESGHFSRECP--------NKAH*AAQPVRS 253 CF C ++GH RECP N + AAQ VR+ Sbjct: 1359 CFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRN 1393
>RBM4_BRARE (Q6IQ97) RNA-binding protein 4 (RNA-binding motif protein 4)| Length = 419 Score = 29.3 bits (64), Expect = 4.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGQEGHWSKECP 176
>RBM4_MOUSE (Q8C7Q4) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (mLark) Length = 361 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_RAT (Q64LC9) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_MOUSE (Q8VE92) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 357 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4_RABIT (Q9BDY9) RNA-binding protein 4 (RNA-binding motif protein 4) (Lark| homolog) Length = 359 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4B_HUMAN (Q9BQ04) RNA-binding protein 4B (RNA-binding motif protein 4B)| (RNA-binding protein 30) (RNA-binding motif protein 30) Length = 359 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7| Length = 542 Score = 28.9 bits (63), Expect = 5.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C++ GH+ ECP + Sbjct: 349 CYHCAQKGHYGHECPER 365
>RBM4_HUMAN (Q9BWF3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) (Lark homolog) (hLark) Length = 364 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>RBM4_BOVIN (Q3MHX3) RNA-binding protein 4 (RNA-binding motif protein 4)| (RNA-binding motif protein 4a) Length = 362 Score = 28.9 bits (63), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 333 CFSCSESGHFSRECP 289 C+ C + GH+S+ECP Sbjct: 162 CYRCGKEGHWSKECP 176
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C C E GH++R+CP K Sbjct: 503 CAYCKEKGHWARDCPKK 519
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C C E GH++R+CP K Sbjct: 503 CAYCKEKGHWARDCPKK 519
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C C E GH++R+CP K Sbjct: 504 CAYCKEKGHWARDCPKK 520
>COAT_CERV (P05399) Probable coat protein| Length = 494 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+ GH++ ECPN+ Sbjct: 420 CWVCNIEGHYANECPNR 436
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 CF C + GHFS++C Sbjct: 402 CFKCKQPGHFSKQC 415
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 CF C + GHFS++C Sbjct: 402 CFKCKQPGHFSKQC 415
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 333 CFSCSESGHFSREC 292 CF C + GHFS++C Sbjct: 402 CFKCKQPGHFSKQC 415
>GAG_HTLV2 (P03346) Gag polyprotein [Contains: Core protein p15 (p19); Core| protein p24; Core protein p12 (p15)] Length = 432 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 333 CFSCSESGHFSRECPNKAH*AAQPVRSECPL 241 CF C + GH+SR+C +P CPL Sbjct: 362 CFRCGKVGHWSRDCTQ-----PRPPPGPCPL 387
>COAT_CAMVN (Q00956) Coat protein| Length = 488 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+ GH++ ECPN+ Sbjct: 412 CWICNIEGHYANECPNR 428
>COAT_CAMVC (P03543) Coat protein| Length = 488 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+ GH++ ECPN+ Sbjct: 412 CWICNIEGHYANECPNR 428
>COAT_CAMVS (P03542) Coat protein| Length = 489 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+ GH++ ECPN+ Sbjct: 414 CWICNIEGHYANECPNR 430
>COAT_CAMVD (P03544) Coat protein| Length = 490 Score = 28.5 bits (62), Expect = 7.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 C+ C+ GH++ ECPN+ Sbjct: 413 CWICNIEGHYANECPNR 429
>YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III| Length = 2186 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 333 CFSCSESGHFSRECPNK 283 CF C+E GH + CP K Sbjct: 591 CFRCNEMGHIAWNCPKK 607 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,111,040 Number of Sequences: 219361 Number of extensions: 535160 Number of successful extensions: 1457 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1455 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)