Clone Name | rbart49c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SDC3_CAEEL (P34706) Zinc finger protein sdc-3 | 31 | 0.71 | 2 | SMS2_CAEEL (Q20735) Putative phosphatidylcholine:ceramide cholin... | 30 | 1.6 | 3 | SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouc... | 28 | 4.6 | 4 | RUMB_VIBCH (Q9KL20) 23S rRNA (uracil-5-)-methyltransferase rumB ... | 28 | 7.8 | 5 | DSBD1_PSEAE (Q9HUW5) Thiol:disulfide interchange protein dsbD 1 ... | 28 | 7.8 |
---|
>SDC3_CAEEL (P34706) Zinc finger protein sdc-3| Length = 2150 Score = 31.2 bits (69), Expect = 0.71 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +3 Query: 45 NTIFSLRVQYISRTTPPSPLIKFRKQKVLLKTRNHQMLHASQRWEGKIIQLIKGSGW*GT 224 + + S V+Y R P ++ + +K++LK ++ W GK + T Sbjct: 721 DALMSKDVKYKPRMIPEKGFLQLQDEKLILK----RLCEKEDEWSGKQKRRFPDLYEQAT 776 Query: 225 KSTPRTGDPDAS 260 + R GDPDAS Sbjct: 777 QEAERLGDPDAS 788
>SMS2_CAEEL (Q20735) Putative phosphatidylcholine:ceramide| cholinephosphotransferase 2 (EC 2.7.-.-) (Sphingomyelin synthase 2) Length = 335 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 229 DFVPYQPLPLINCIIFPSQRW 167 D VP QPLP + +I P QRW Sbjct: 82 DVVPRQPLPDLTFMIIPQQRW 102
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 18 HPYTRPRHCNTIFSLRVQYISRTTPPSP 101 HP+ P H + +F LR S T PPSP Sbjct: 227 HPHPHP-HPSAVFHLRAPSSSSTAPPSP 253
>RUMB_VIBCH (Q9KL20) 23S rRNA (uracil-5-)-methyltransferase rumB (EC 2.1.1.-)| (23S rRNA(M-5-U747)-methyltransferase) Length = 375 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 256 ASGSPVRGVDFVPYQPLPLINCIIFPS--QRWLA*SI*WFRV 137 A+ +P+ G++ QPL L+ C ++P Q LA W R+ Sbjct: 66 AAHAPILGIEDAQGQPLSLVTCPLYPQPMQELLAYLENWIRI 107
>DSBD1_PSEAE (Q9HUW5) Thiol:disulfide interchange protein dsbD 1 precursor (EC| 1.8.1.8) (Protein-disulfide reductase 1) (Disulfide reductase 1) Length = 591 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +1 Query: 220 ERNPLH--ARGIPMLHAGPDRTP 282 E +P+H R +P +HAGP TP Sbjct: 447 ESDPIHPLGRSVPSIHAGPPSTP 469 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,699,892 Number of Sequences: 219361 Number of extensions: 829148 Number of successful extensions: 1636 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)