Clone Name | rbart49c09 |
---|---|
Clone Library Name | barley_pub |
>TAB3_XENLA (Q7ZXH3) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 homolog Length = 692 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 240 RLPFDVLRSPPTSVGSSPFDLPRHRI 317 ++P RSPPTS +SP+ P+H++ Sbjct: 262 QIPQSAFRSPPTSQCTSPYSSPQHQV 287
>GRP78_PICAN (Q9HG01) 78 kDa glucose-regulated protein homolog precursor (GRP| 78) (Immunoglobulin heavy chain-binding protein homolog) (BiP) Length = 665 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 260 EDVEGKAEVAARAEQFIRQFREELKLERINSILNYTHALRRTA 132 E++E K E A + Q ++ RE K+E N++ NY H+L+ A Sbjct: 546 EEIEKKIEEAEKFAQQDKELRE--KVESRNALENYAHSLKNQA 586
>MURG_MYCTU (O06224) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 410 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 300 LPRHRICGGLPLPPRARQRVRLV 368 LP + GLPLPPR R+R+ +V Sbjct: 140 LPAYLAARGLPLPPRRRRRIPVV 162
>MURG_MYCBO (Q7VEP8) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 410 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 300 LPRHRICGGLPLPPRARQRVRLV 368 LP + GLPLPPR R+R+ +V Sbjct: 140 LPAYLAARGLPLPPRRRRRIPVV 162
>APX8_ORYSA (Q69SV0) Probable L-ascorbate peroxidase 8, chloroplast precursor| (EC 1.11.1.11) Length = 478 Score = 28.9 bits (63), Expect = 3.1 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 226 RAATSAFPSTSSVPRPHP*APRPLTFLGTVSAADCRCRPARASAYASSKLMDSPS 390 R A S P+ S P P P PRP VSAA P +++ +L PS Sbjct: 4 RIAASLLPAASPSPAPSPPPPRP-----RVSAAAAASFPCCSTSAGGLRLRSRPS 53
>E74EA_DROME (P20105) Ecdysone-induced protein 74EF isoform A (ETS-related| protein E74A) Length = 829 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 168 HPQLHPRAAPHRRGTVAGAAARPIVS 91 HP HP A H T+A AAA S Sbjct: 625 HPHSHPHAGQHTHSTIAAAAAAAAAS 650
>E74EB_DROME (P11536) Ecdysone-induced protein 74EF isoform B (ETS-related| protein E74B) Length = 883 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 168 HPQLHPRAAPHRRGTVAGAAARPIVS 91 HP HP A H T+A AAA S Sbjct: 679 HPHSHPHAGQHTHSTIAAAAAAAAAS 704
>FES_MOUSE (P16879) Proto-oncogene tyrosine-protein kinase Fes/Fps (EC| 2.7.10.2) (C-Fes) Length = 820 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 81 HNQTRRWAERRHRLPCP 131 + QTR + E+ HRLPCP Sbjct: 764 NQQTREFVEKGHRLPCP 780
>SLIT3_RAT (O88280) Slit homolog 3 protein precursor (Slit-3) (Multiple| epidermal growth factor-like domains 5) Length = 1523 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 228 RGHLRLPFDVLRSPPTSVGS 287 +GH+RL +D L SPPT+V S Sbjct: 1210 QGHVRLVYDSLSSPPTTVYS 1229
>SLIT3_MOUSE (Q9WVB4) Slit homolog 3 protein precursor (Slit-3) (Slit3)| Length = 1523 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 228 RGHLRLPFDVLRSPPTSVGS 287 +GH+RL +D L SPPT+V S Sbjct: 1210 QGHVRLVYDSLSSPPTTVYS 1229
>SLIT3_HUMAN (O75094) Slit homolog 3 protein precursor (Slit-3) (Multiple| epidermal growth factor-like domains 5) Length = 1523 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 228 RGHLRLPFDVLRSPPTSVGS 287 +GH+RL +D L SPPT+V S Sbjct: 1210 QGHVRLVYDSLSSPPTTVYS 1229
>GPA1_EMENI (Q00743) Guanine nucleotide-binding protein alpha subunit| Length = 352 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 278 GCGRGTEDVEGKAEVAARAEQFIRQFREELKLER 177 GCG TED EGK AR E+ Q + + ++R Sbjct: 1 GCGMSTEDKEGK----ARNEEIENQLKRDKMMQR 30
>GPA1_COLTR (O42784) Guanine nucleotide-binding protein alpha subunit| Length = 352 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 278 GCGRGTEDVEGKAEVAARAEQFIRQFREELKLER 177 GCG TED EGK AR E+ Q + + ++R Sbjct: 1 GCGMSTEDKEGK----ARNEEIENQLKRDKMMQR 30
>SQSTM_RAT (O08623) Sequestosome-1 (Ubiquitin-binding protein p62) (Protein| kinase C-zeta-interacting protein) (PKC-zeta-interacting protein) Length = 439 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +3 Query: 12 VAFSGGMIHQSKMLYRANEIFSLHNQTRRWAERRHRLPCPGGAAQRV--GVVEDG 170 VAFS M Y ++IF ++ + ++ R HR PC A V V+ DG Sbjct: 73 VAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEARSMVHPNVICDG 127
>TAB3_MOUSE (Q571K4) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 (TAK1-binding protein 3) Length = 716 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 240 RLPFDVLRSPPTSVGSSPFDLPRHRI 317 ++P V SPP S SPF P+H++ Sbjct: 286 QIPQSVYHSPPPSQCPSPFSSPQHQV 311
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 48 MLYRANEIFSLHNQTRRWAERRHR 119 M+YR ++ LH + RW+ R HR Sbjct: 538 MIYRLPQVLRLHLKRFRWSGRNHR 561
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 48 MLYRANEIFSLHNQTRRWAERRHR 119 M+YR ++ LH + RW+ R HR Sbjct: 541 MIYRLPQVLRLHLKRFRWSGRNHR 564
>RS5_GLUOX (Q5FU00) 30S ribosomal protein S5| Length = 191 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -3 Query: 377 ISLDEAYALARAGRQRQSAADTVPRKVKGRGAYGCGRGTEDVEGKAEVAARAEQ 216 ++++ + + GR+ AA V KGR YG G+ E E + RA++ Sbjct: 26 VTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYGAGKAREVPEAIRKATERAKR 79
>FIXC_BRAJA (P10331) Protein fixC| Length = 435 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -3 Query: 290 RGAYGCGRGTEDVEGKAEVAARAEQFIRQFREELKLER 177 RG Y G+++V+G A E+ I +FREE LER Sbjct: 36 RGEYP---GSKNVQGAILYADMMEKLIPEFREEAPLER 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,737,377 Number of Sequences: 219361 Number of extensions: 841201 Number of successful extensions: 3377 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 3302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3377 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)