Clone Name | rbart49c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BLNK_HUMAN (Q8WV28) B-cell linker protein (Cytoplasmic adapter p... | 30 | 1.5 | 2 | PIT_BUCAI (P57647) Low-affinity inorganic phosphate transporter | 27 | 10.0 |
---|
>BLNK_HUMAN (Q8WV28) B-cell linker protein (Cytoplasmic adapter protein)| (B-cell adapter containing SH2 domain protein) (B-cell adapter containing Src homology 2 domain protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65) Length = 456 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 138 GSNNGARRTINPAP*KPSRTREA*HKIITEIKSSRTAGEVNRLSSAQQTP 287 G N+GA T +P P PS A K T +K++ A + N S ++ P Sbjct: 226 GRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKP 275
>PIT_BUCAI (P57647) Low-affinity inorganic phosphate transporter| Length = 490 Score = 27.3 bits (59), Expect = 10.0 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -3 Query: 229 ISVIILCYASLVRDGF*GAGLIVLLAPLLDPSSIFMYVLNTSK 101 +S I + YA DG G GLI+L+ + PSS F+ LNT+K Sbjct: 216 LSSIGVSYAHGANDGQKGIGLIMLVLIGIVPSS-FLVNLNTNK 257 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,458,834 Number of Sequences: 219361 Number of extensions: 711209 Number of successful extensions: 1216 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1215 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)