Clone Name | rbart49b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TMPC_TREPA (P29724) Membrane lipoprotein tmpC precursor (Membran... | 30 | 3.2 | 2 | SYGM2_ARATH (Q8L785) Glycyl-tRNA synthetase 2, chloroplast/mitoc... | 29 | 7.2 |
---|
>TMPC_TREPA (P29724) Membrane lipoprotein tmpC precursor (Membrane protein C)| (35 kDa antigen) (Lipoprotein TpN35) Length = 353 Score = 30.0 bits (66), Expect = 3.2 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -1 Query: 162 LVVFNVPTASSSNSGRALTAKLFDGGVN*IL*ISG 58 +VV T S G+AL AKL+D GVN I ++G Sbjct: 198 VVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAG 232
>SYGM2_ARATH (Q8L785) Glycyl-tRNA synthetase 2, chloroplast/mitochondrial| precursor (EC 6.1.1.14) (Glycine--tRNA ligase 2) (GlyRS 2) Length = 1067 Score = 28.9 bits (63), Expect = 7.2 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -3 Query: 475 NVTVYSTTLRGTGVSFSDEQRKQLAAEQAARALPLTVEARLPV 347 N Y T+R +G++ E+RK++ E+ + AL +V RL V Sbjct: 580 NAESYEDTMRNSGINIEIEERKKIILEK-SNALAKSVSGRLVV 621 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,297,122 Number of Sequences: 219361 Number of extensions: 607978 Number of successful extensions: 2012 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2000 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)