Clone Name | rbart49a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GCH1_DROME (P48596) GTP cyclohydrolase I (EC 3.5.4.16) (GTP-CH-I... | 31 | 0.92 | 2 | YJV5_YEAST (P40895) Hypothetical 13.9 kDa protein in HXT11-HXT8 ... | 29 | 2.7 |
---|
>GCH1_DROME (P48596) GTP cyclohydrolase I (EC 3.5.4.16) (GTP-CH-I) (Protein| punch) Length = 324 Score = 30.8 bits (68), Expect = 0.92 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 187 LTSRVSLRCPPGSDTCRWNHPLNRDH*PPVTILLLP 294 LT R S PG + C ++H L DH PP LLP Sbjct: 109 LTPRTSTT--PGHEKCTFHHDLELDHKPPTREALLP 142
>YJV5_YEAST (P40895) Hypothetical 13.9 kDa protein in HXT11-HXT8 intergenic| region Length = 119 Score = 29.3 bits (64), Expect = 2.7 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 32 KYLLIWLRKLKYYAKKAVKIPKVLMVPLNLEQARVSIYPR 151 +++L +LR ++AKK +IPK+L V EQAR Y R Sbjct: 16 QFILFYLRVHVFHAKKRSEIPKLLRVQ---EQARSRNYSR 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,039,724 Number of Sequences: 219361 Number of extensions: 635952 Number of successful extensions: 1386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1386 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)